(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE367

MICSR_1.PE367        Location/Qualifiers
FT   CDS             join(705048..705256,705359..705587,705834..>706004)
FT                   /codon_start=1
FT                   /gene_family="HOG000003584" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636997"
FT                   /orf_name="MICPUN_80272"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO61777.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG706903"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniParc:UPI000199A8AF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P4"
FT                   /transl_table=1
FT                   /translation="MLREKADMGDPKAMSDLGATYFQGDELPRDHSTAFAWFERSATAG
FT                   YTLAFVNLATCYREGLGCPKDERKAEGAYWFRRGAEAGSLECSYRWGVCCATGTGAERD
FT                   FGNAAEAFRFAAERGHAGAALDLGHCLMNGLGIIGGAKKSMAAWYERAVALGVTDAAAA
FT                   LGRMHRDGVGGDETTRDLDEASKWFRISAAGGDDASAQAL"
     MLREKADMGD PKAMSDLGAT YFQGDELPRD HSTAFAWFER SATAGYTLAF VNLATCYREG        60
     LGCPKDERKA EGAYWFRRGA EAGSLECSYR WGVCCATGTG AERDFGNAAE AFRFAAERGH       120
     AGAALDLGHC LMNGLGIIGG AKKSMAAWYE RAVALGVTDA AAALGRMHRD GVGGDETTRD       180
     LDEASKWFRI SAAGGDDASA QAL                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page