(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE368

MICSR_1.PE368        Location/Qualifiers
FT   CDS             join(complement(708218..708724),complement(707003..708115))
FT                   /codon_start=1
FT                   /gene_family="HOG000021559" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636998"
FT                   /orf_name="MICPUN_56945"
FT                   /product="Pyruvate kinase"
FT                   /function="magnesium ion binding"
FT                   /function="potassium ion binding"
FT                   /function="pyruvate kinase activity"
FT                   /biological_process="glycolysis"
FT                   /protein_id="ACO62203.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004743"
FT                   /db_xref="GO:0006096"
FT                   /db_xref="GO:0030955"
FT                   /db_xref="HOGENOM:HBG734376"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015794"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="UniParc:UPI000199A8B0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P5"
FT                   /transl_table=1
FT                   /translation="MANIQVDDILAGTPAVQCKTKVRAPSAPTTRDPPARFLTRLANYG
FT                   IPLAPEQIVCTLGPKSAELSIMEDLLRAGMSVARFNFSHGSHEYHQGTLNTLRQAMLNT
FT                   RLMCAVLLDTKGPEIRTGMLKGGKPVLMEAGREVTIHTDYTLHGDEHNIAMSYKKLPND
FT                   VAPGAEILIGDGSIVMVVLSCHPENGTVRCRCANTAMLGERKNVNLPGVVVDLPTITEK
FT                   DRDDILGWGVPNGIDFIAASFVRKGSDVRYIREVLGEEGKSIKIISKVENQEGLVNFDD
FT                   ILEESDGVMVARGDLGMEIPTEKIFLAQKLMIEKCNAAGKPVVTATQMLESMVKNPRPT
FT                   RAEATDVANAVLDGTDCVMLSGETAAGAFPVDAVRVMSKICREAEVSIDHYQLFKSILA
FT                   QVPIPMQPLESLASSAVRTAQKVRAALIVVLTHGGSTARLVAKYRPAVPVLTVFVPTLT
FT                   TDSLTWQCSGESPARQANLTRGLIPLLAEGSARATDTDTTDEILHAAIDHAKAAGYCAS
FT                   GECIVALHRIGNASVIKIVNIP"
     MANIQVDDIL AGTPAVQCKT KVRAPSAPTT RDPPARFLTR LANYGIPLAP EQIVCTLGPK        60
     SAELSIMEDL LRAGMSVARF NFSHGSHEYH QGTLNTLRQA MLNTRLMCAV LLDTKGPEIR       120
     TGMLKGGKPV LMEAGREVTI HTDYTLHGDE HNIAMSYKKL PNDVAPGAEI LIGDGSIVMV       180
     VLSCHPENGT VRCRCANTAM LGERKNVNLP GVVVDLPTIT EKDRDDILGW GVPNGIDFIA       240
     ASFVRKGSDV RYIREVLGEE GKSIKIISKV ENQEGLVNFD DILEESDGVM VARGDLGMEI       300
     PTEKIFLAQK LMIEKCNAAG KPVVTATQML ESMVKNPRPT RAEATDVANA VLDGTDCVML       360
     SGETAAGAFP VDAVRVMSKI CREAEVSIDH YQLFKSILAQ VPIPMQPLES LASSAVRTAQ       420
     KVRAALIVVL THGGSTARLV AKYRPAVPVL TVFVPTLTTD SLTWQCSGES PARQANLTRG       480
     LIPLLAEGSA RATDTDTTDE ILHAAIDHAK AAGYCASGEC IVALHRIGNA SVIKIVNIP        539
//

If you have problems or comments...

PBIL Back to PBIL home page