(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE369

MICSR_1.PE369        Location/Qualifiers
FT   CDS             join(complement(710404..710784),complement(709621..710307))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636999"
FT                   /orf_name="MICPUN_105273"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO62204.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012287"
FT                   /db_xref="InterPro:IPR014778"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR020478"
FT                   /db_xref="UniParc:UPI000199A8B1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P6"
FT                   /transl_table=1
FT                   /translation="MHPPPEGLSQAPAKRGRGRPRKDAPKPIPAPKEAPAKRGRGRPRK
FT                   DAPATEKTAPEKKPAKPNAAVKRRAPPAVKEVGQHSDDESLDELIAAEKAKERAPPPPP
FT                   EPAVENWTISMATPMGTLPVEVTSLVTVTDIKQLVTAKTGGRLPPDRQIIKLNERLIDD
FT                   FGPNATLANHGLKHRSMLTLTFIRNAKSPAKSPTVDRTREHSRALQTVPSPPREERPAK
FT                   ERRTGWQPESVTRRVGPRERDQSAQGTKHKWTREESELVAEGVAKYGYGEWAAIQKELF
FT                   AESARTSTDIKDRWRNMLKAASKPNDFKFRSFMDDDLREQINEAQNKADEYQQKKLMEV
FT                   ERQRQEMIRVRGQIA"
     MHPPPEGLSQ APAKRGRGRP RKDAPKPIPA PKEAPAKRGR GRPRKDAPAT EKTAPEKKPA        60
     KPNAAVKRRA PPAVKEVGQH SDDESLDELI AAEKAKERAP PPPPEPAVEN WTISMATPMG       120
     TLPVEVTSLV TVTDIKQLVT AKTGGRLPPD RQIIKLNERL IDDFGPNATL ANHGLKHRSM       180
     LTLTFIRNAK SPAKSPTVDR TREHSRALQT VPSPPREERP AKERRTGWQP ESVTRRVGPR       240
     ERDQSAQGTK HKWTREESEL VAEGVAKYGY GEWAAIQKEL FAESARTSTD IKDRWRNMLK       300
     AASKPNDFKF RSFMDDDLRE QINEAQNKAD EYQQKKLMEV ERQRQEMIRV RGQIA            355
//

If you have problems or comments...

PBIL Back to PBIL home page