(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE370

MICSR_1.PE370        Location/Qualifiers
FT   CDS             join(complement(712198..712947),complement(711736..712143),
FT                   complement(711058..711630))
FT                   /codon_start=1
FT                   /gene_family="HOG000198032" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637000"
FT                   /orf_name="MICPUN_79957"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62205.1"
FT                   /db_xref="HOGENOM:HBG559594"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniParc:UPI000199A8B2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P7"
FT                   /transl_table=1
FT                   /translation="MTAARAAASALGAKTEIPAPRRPVGLSRAVRARPRRALAEDRDVS
FT                   KLSSPGRPRTLGWGRKRGSVGPDEDLLADPDTHGYCVYSHADWSYAYKSVAGEFDSIRD
FT                   GGDVVGTIPDELIGGVLYRNGPGLFERGGREYNHMLDGDGYVLRFEFSDAKTARFASRF
FT                   VRTKEFRAEEEADDVLYRGTFGTMRAGGPLRNALDLHQKNLANTNILAWGGKVYALYEA
FT                   GRPVELDPKTLETVGEVDLNGRLSGGMFAFTAHPHVDPNTGRVVGWGWTSAVAKRSVEA
FT                   TFWEWDKNWGEVASTEYSMSGCEAAPHDFAVTESWYVMIQNCLRVDPLLYLAGVKGAGE
FT                   CLVSQPEDPVTVHLIPRRDAGFDGGADKSGRAAVAAAGPRESFEIHLEPGSFLGEWSQS
FT                   AGWDFDIATSLSPDFNNIPRTLLWRYRINARTGTVFREPAPGCEDLCIDHPHVNPMFEG
FT                   RRECRYVYASISNEVRCSGPPLGYVRIDVATGKTQRWWAGNRTFCEEVVLVPKKGSDGS
FT                   PGSDDRCWVLGMCVAHDAEGAGRSSLVVLDGEDLGKGPVARVWLDNQIPHGLHGMFVPA
FT                   "
     MTAARAAASA LGAKTEIPAP RRPVGLSRAV RARPRRALAE DRDVSKLSSP GRPRTLGWGR        60
     KRGSVGPDED LLADPDTHGY CVYSHADWSY AYKSVAGEFD SIRDGGDVVG TIPDELIGGV       120
     LYRNGPGLFE RGGREYNHML DGDGYVLRFE FSDAKTARFA SRFVRTKEFR AEEEADDVLY       180
     RGTFGTMRAG GPLRNALDLH QKNLANTNIL AWGGKVYALY EAGRPVELDP KTLETVGEVD       240
     LNGRLSGGMF AFTAHPHVDP NTGRVVGWGW TSAVAKRSVE ATFWEWDKNW GEVASTEYSM       300
     SGCEAAPHDF AVTESWYVMI QNCLRVDPLL YLAGVKGAGE CLVSQPEDPV TVHLIPRRDA       360
     GFDGGADKSG RAAVAAAGPR ESFEIHLEPG SFLGEWSQSA GWDFDIATSL SPDFNNIPRT       420
     LLWRYRINAR TGTVFREPAP GCEDLCIDHP HVNPMFEGRR ECRYVYASIS NEVRCSGPPL       480
     GYVRIDVATG KTQRWWAGNR TFCEEVVLVP KKGSDGSPGS DDRCWVLGMC VAHDAEGAGR       540
     SSLVVLDGED LGKGPVARVW LDNQIPHGLH GMFVPA                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page