(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE373

MICSR_1.PE373        Location/Qualifiers
FT   CDS             complement(716984..717385)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637003"
FT                   /orf_name="MICPUN_56951"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62207.1"
FT                   /db_xref="HOGENOM:HBG607303"
FT                   /db_xref="UniParc:UPI000199A8B5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q0"
FT                   /transl_table=1
FT                   /translation="MVATRRTPAKGKAEPAAKTPAKKSAAGKKGAAGAKLDPDGNEMTP
FT                   VYYLRQYVGLFFTLLSFAFIAFAGYATQYGFSSANIFLYPGCAIGFVGLAFHELRPYKT
FT                   KAQMTFDPAAVEYRKKEIAEAEKRAKKSK"
     MVATRRTPAK GKAEPAAKTP AKKSAAGKKG AAGAKLDPDG NEMTPVYYLR QYVGLFFTLL        60
     SFAFIAFAGY ATQYGFSSAN IFLYPGCAIG FVGLAFHELR PYKTKAQMTF DPAAVEYRKK       120
     EIAEAEKRAK KSK                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page