(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE374

MICSR_1.PE374        Location/Qualifiers
FT   CDS             join(complement(727082..729780),complement(726241..726994),
FT                   complement(723904..725445))
FT                   /codon_start=1
FT                   /gene_family="HOG000264435" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637004"
FT                   /orf_name="MICPUN_93685"
FT                   /product="Predicted protein"
FT                   /function="acyl carrier activity"
FT                   /function="cofactor binding"
FT                   /function="transferase activity"
FT                   /protein_id="ACO62208.1"
FT                   /db_xref="GO:0000036"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="GO:0048037"
FT                   /db_xref="HOGENOM:HBG560171"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR006163"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniParc:UPI000199A916"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q1"
FT                   /transl_table=1
FT                   /translation="MAGAASEASDLTTPLISGNQPAATFSSRGGNRRSGRRRASGESGA
FT                   GAHDSDGGSPAPRHSHVESPLAAADHEGITVEPLAPLADLLVEATNTRVRQGYLSGDWL
FT                   AERLPAYSSISDLIANSSRPAITPVDARASLTHTQLKDLIYRVDDELKTWGVTQAGSRV
FT                   GVAVPNGPELMSVLLSVIDRHTCVPVNPATTPQEMHEELRATGVVALVYQGGNEMAVTM
FT                   RKLCEKLKIVPLAITPDPNVGGLFSISSDAGDASGSRAGPGTYAPPDSDKNRTALVLHT
FT                   SGSTGKKKIVPISLHQLVLGATAIGASSGLGQNDVCLNFMPLFHVGGICRNLLAPIFAG
FT                   GSTVAMPFFDADDFWQTAVQKQCTWYYGAPTMHLLVVNSAKAMPTDQIPETKIRFIANA
FT                   AGPLLPSVAIELRKVFNGAAVLTSYGMTECMPIACPPPGYALERAGSSGQAICPEIAIV
FT                   DDSGERVANGRVAHIVVKGSIVTRGYENDPEATKASFHPGGWFKTGDMGWMDADGYLYV
FT                   TGRSKEVINRGGEIISPAEVEEALQSHPGVADVVAISIPHATLQETVAVVVVPTRGIQE
FT                   PGLRQLCQHASDRLPPAKWPQCLVLVESIPKLATGKVSRSAIAKSLDIQEIRDGMWELD
FT                   VTFEASLEVNAGRGSSGVAGHRAIATRDEATKRVAEALSKASGVEDTAACIDTTGSNAL
FT                   IGAVTPADADTEKVMSFACRCLPGFLEPKDVIAVDEIPRAADGKCDAQALLALWKGQKA
FT                   AGVNGAAFTATQRAVAEAWANTLNCDARTVGLDDDFFQVGGSSIVAGQLAADIRRKLSS
FT                   NLTGADIFRYRTVKEIAAKVEKEGGGTKDGNKTEGGLPPSMASKPLGPMEWTRSYSSTS
FT                   FFALLFQSLPLLVFAPMQKILRWTIFLNMAAGVDPENEHFHHLRLVAFFVALVFTGLIS
FT                   FVLFPVMTVMLKWTVLGRLKPGLHPLWGSVYIRWWLSNKAVEVSGFGIFGMSDGLFRIY
FT                   LRMMGARVGRGAKIGRLVRIADFDMLEIHTNAAVDDYAHLRAAEVRRGALRVAPVYLGP
FT                   GSTVCTRAVVGPGGVVPQGATLGPYMSWRELDVTNPKTMAQMEEHRKIARMRQPQPGFG
FT                   SQMLAWPIVFVCEVVAWIPWIFVFVVLIRSQGLYLSIPGQGGLHDCITWFMDPFRLGVI
FT                   FAARVGHNIFGPLLQLIWIVLVKWIVVGKFKPGPLPRTYLAREWELTRRWLMNKLLPKG
FT                   DFRGALAVLGKHYEYTSIVYRMLGAKIGKRVFWPGSGVLVADGMYDLVDIGDDVVWGSR
FT                   SMVFPADCTSSLPVSICRGANVSDRCVIYAGVTLMDDACLGSGAVAPRKMKYDYGSIHV
FT                   GSRNGACVQLDPGSKPDDSVPREPKPFGRAVYQRKATYFLPHWQVMPFVFSFFIALRTA
FT                   YSVMPIWVSWYLVAIITWDLGNNFWTEMPEWRYLLLLIFVYLWVNMIHVVVRFIIDTGL
FT                   KWLIIGRREPGLYPWDRSSYCIRWKIFESLCSDTLHSLRLIGGSAFLPFFYNIMGSRIG
FT                   RRVCLYPTGADPPMVEPDLVVIEDGACVNFTHIICHTNTLGSFALNHIVIKSGATLSTE
FT                   SRIMGGVVIGEDAVLLEHTMAMVGDVVEPGDIWQGWPVQAIAKADEVAKSAKDSAEKAE
FT                   KVHEGKVLPLGLKEMPKPHKSYGSHR"
     MAGAASEASD LTTPLISGNQ PAATFSSRGG NRRSGRRRAS GESGAGAHDS DGGSPAPRHS        60
     HVESPLAAAD HEGITVEPLA PLADLLVEAT NTRVRQGYLS GDWLAERLPA YSSISDLIAN       120
     SSRPAITPVD ARASLTHTQL KDLIYRVDDE LKTWGVTQAG SRVGVAVPNG PELMSVLLSV       180
     IDRHTCVPVN PATTPQEMHE ELRATGVVAL VYQGGNEMAV TMRKLCEKLK IVPLAITPDP       240
     NVGGLFSISS DAGDASGSRA GPGTYAPPDS DKNRTALVLH TSGSTGKKKI VPISLHQLVL       300
     GATAIGASSG LGQNDVCLNF MPLFHVGGIC RNLLAPIFAG GSTVAMPFFD ADDFWQTAVQ       360
     KQCTWYYGAP TMHLLVVNSA KAMPTDQIPE TKIRFIANAA GPLLPSVAIE LRKVFNGAAV       420
     LTSYGMTECM PIACPPPGYA LERAGSSGQA ICPEIAIVDD SGERVANGRV AHIVVKGSIV       480
     TRGYENDPEA TKASFHPGGW FKTGDMGWMD ADGYLYVTGR SKEVINRGGE IISPAEVEEA       540
     LQSHPGVADV VAISIPHATL QETVAVVVVP TRGIQEPGLR QLCQHASDRL PPAKWPQCLV       600
     LVESIPKLAT GKVSRSAIAK SLDIQEIRDG MWELDVTFEA SLEVNAGRGS SGVAGHRAIA       660
     TRDEATKRVA EALSKASGVE DTAACIDTTG SNALIGAVTP ADADTEKVMS FACRCLPGFL       720
     EPKDVIAVDE IPRAADGKCD AQALLALWKG QKAAGVNGAA FTATQRAVAE AWANTLNCDA       780
     RTVGLDDDFF QVGGSSIVAG QLAADIRRKL SSNLTGADIF RYRTVKEIAA KVEKEGGGTK       840
     DGNKTEGGLP PSMASKPLGP MEWTRSYSST SFFALLFQSL PLLVFAPMQK ILRWTIFLNM       900
     AAGVDPENEH FHHLRLVAFF VALVFTGLIS FVLFPVMTVM LKWTVLGRLK PGLHPLWGSV       960
     YIRWWLSNKA VEVSGFGIFG MSDGLFRIYL RMMGARVGRG AKIGRLVRIA DFDMLEIHTN      1020
     AAVDDYAHLR AAEVRRGALR VAPVYLGPGS TVCTRAVVGP GGVVPQGATL GPYMSWRELD      1080
     VTNPKTMAQM EEHRKIARMR QPQPGFGSQM LAWPIVFVCE VVAWIPWIFV FVVLIRSQGL      1140
     YLSIPGQGGL HDCITWFMDP FRLGVIFAAR VGHNIFGPLL QLIWIVLVKW IVVGKFKPGP      1200
     LPRTYLAREW ELTRRWLMNK LLPKGDFRGA LAVLGKHYEY TSIVYRMLGA KIGKRVFWPG      1260
     SGVLVADGMY DLVDIGDDVV WGSRSMVFPA DCTSSLPVSI CRGANVSDRC VIYAGVTLMD      1320
     DACLGSGAVA PRKMKYDYGS IHVGSRNGAC VQLDPGSKPD DSVPREPKPF GRAVYQRKAT      1380
     YFLPHWQVMP FVFSFFIALR TAYSVMPIWV SWYLVAIITW DLGNNFWTEM PEWRYLLLLI      1440
     FVYLWVNMIH VVVRFIIDTG LKWLIIGRRE PGLYPWDRSS YCIRWKIFES LCSDTLHSLR      1500
     LIGGSAFLPF FYNIMGSRIG RRVCLYPTGA DPPMVEPDLV VIEDGACVNF THIICHTNTL      1560
     GSFALNHIVI KSGATLSTES RIMGGVVIGE DAVLLEHTMA MVGDVVEPGD IWQGWPVQAI      1620
     AKADEVAKSA KDSAEKAEKV HEGKVLPLGL KEMPKPHKSY GSHR                       1664
//

If you have problems or comments...

PBIL Back to PBIL home page