(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE375

MICSR_1.PE375        Location/Qualifiers
FT   CDS             730852..732429
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637005"
FT                   /orf_name="MICPUN_52223"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61779.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="UniParc:UPI000199A917"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q2"
FT                   /transl_table=1
FT                   /translation="MSPRRAAAKHAETETVDATPEAMENPAEEVVAEQSASGDPTKAET
FT                   VDGSAEVAKQGTKRKAEAGARMDDPSPKNEPTGSPEYNREDEMGGSKSRVCRVDGCDVV
FT                   FSTAHECRARACQKHCSALFVRLKGARPDEQFRFCYQCHKFHPLDNFRGPDGTLLARHN
FT                   CSQSQVQRLERRKRKDALKASKKMAEALGLNHPAQIEAVNLIGASNVGQLLLANQLVMH
FT                   ERLLAAIGAGGGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGL
FT                   GAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGSGAAQGLGAAQGLGALQALIGAQG
FT                   VGAAGSAQANALNQQLGKQQLPQQLEALAALRQREQLAMLNQAAGVKGLAGTQLSGLGP
FT                   AVANGGLHGGAGVSAMLDAAVRQEKLNMLSATMANMVPSPAVGPAAASGLQGLQGLQGA
FT                   AAGLQGLQGAAAGLQGLQGAAAGLQGAAAGLLWLQGAAANAPGANLNGDILKSLMGQLG
FT                   HNGQNQPQ"
     MSPRRAAAKH AETETVDATP EAMENPAEEV VAEQSASGDP TKAETVDGSA EVAKQGTKRK        60
     AEAGARMDDP SPKNEPTGSP EYNREDEMGG SKSRVCRVDG CDVVFSTAHE CRARACQKHC       120
     SALFVRLKGA RPDEQFRFCY QCHKFHPLDN FRGPDGTLLA RHNCSQSQVQ RLERRKRKDA       180
     LKASKKMAEA LGLNHPAQIE AVNLIGASNV GQLLLANQLV MHERLLAAIG AGGGAAQGLG       240
     AAQGLGAAQG LGAAQGLGAA QGLGAAQGLG AAQGLGAAQG LGAAQGLGAA QGLGAAQGLG       300
     AAQGLGAAQG LGAAQGSGAA QGLGAAQGLG ALQALIGAQG VGAAGSAQAN ALNQQLGKQQ       360
     LPQQLEALAA LRQREQLAML NQAAGVKGLA GTQLSGLGPA VANGGLHGGA GVSAMLDAAV       420
     RQEKLNMLSA TMANMVPSPA VGPAAASGLQ GLQGLQGAAA GLQGLQGAAA GLQGLQGAAA       480
     GLQGAAAGLL WLQGAAANAP GANLNGDILK SLMGQLGHNG QNQPQ                       525
//

If you have problems or comments...

PBIL Back to PBIL home page