(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE376

MICSR_1.PE376        Location/Qualifiers
FT   CDS             complement(732650..733906)
FT                   /codon_start=1
FT                   /gene_family="HOG000193909" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637006"
FT                   /orf_name="MICPUN_107913"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /function="enzyme regulator activity"
FT                   /biological_process="regulation of protein catabolic
FT                   process"
FT                   /cellular_component="proteasome complex"
FT                   /protein_id="ACO62209.1"
FT                   /db_xref="GO:0000502"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0030234"
FT                   /db_xref="GO:0042176"
FT                   /db_xref="HOGENOM:HBG523170"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013143"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="UniParc:UPI000199A918"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q3"
FT                   /transl_table=1
FT                   /translation="MADVAEGGEASATKDDTAGDNAGDGANAVPPTPPTPAQRELPETE
FT                   AYSHLLVLLLLLDANDPECKAASVAALNRLSQFNRRTLDALQARIVFYYSLAHERFGEL
FT                   AEVRPSLLALHRVAALRFDEMGQETILNLLMRNYLHYNMYDQAEKLRSKAQLPASRSNQ
FT                   QQCRYLYYLGRIRAIQLEYSDAKECLTQAHRKAPKLAKGFALELTKWITVVRLLLGEIP
FT                   EKKDLTTAVSGGAAAQRALLPYLELTGAVRLGDLEKFRAVQEAHEAAFRADKTTNLVTR
FT                   LRRNVIRTGLRRVSLAYSAISLDDVAQKLGLGEGDGDVEFVVAKAIRDGGIDATIDHDA
FT                   RTMHSSDATDVYSTGEPQAAFHARIAFCLDTHNEAVKAMRYPDKVKKGKGDGERKSAKD
FT                   RDLEELAMHIMDEDEMDEF"
     MADVAEGGEA SATKDDTAGD NAGDGANAVP PTPPTPAQRE LPETEAYSHL LVLLLLLDAN        60
     DPECKAASVA ALNRLSQFNR RTLDALQARI VFYYSLAHER FGELAEVRPS LLALHRVAAL       120
     RFDEMGQETI LNLLMRNYLH YNMYDQAEKL RSKAQLPASR SNQQQCRYLY YLGRIRAIQL       180
     EYSDAKECLT QAHRKAPKLA KGFALELTKW ITVVRLLLGE IPEKKDLTTA VSGGAAAQRA       240
     LLPYLELTGA VRLGDLEKFR AVQEAHEAAF RADKTTNLVT RLRRNVIRTG LRRVSLAYSA       300
     ISLDDVAQKL GLGEGDGDVE FVVAKAIRDG GIDATIDHDA RTMHSSDATD VYSTGEPQAA       360
     FHARIAFCLD THNEAVKAMR YPDKVKKGKG DGERKSAKDR DLEELAMHIM DEDEMDEF         418
//

If you have problems or comments...

PBIL Back to PBIL home page