(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE378

MICSR_1.PE378        Location/Qualifiers
FT   CDS             join(complement(739742..739852),complement(735908..739612))
FT                   /codon_start=1
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637008"
FT                   /orf_name="MICPUN_56957"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62210.1"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniParc:UPI000199A91A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q5"
FT                   /transl_table=1
FT                   /translation="MPWERVLRETPSPYPGAVAWSHENLIAVGQERSVCILNPADIDGP
FT                   AGCVSLVDDARAKPANANDEDADDHGDDGDGGVPFPELTRPRRSTSLLSTRVVIHPNHR
FT                   PEVVARDLAWSPLGLAPPAVSPSGILGDGCLLAIASSAHRVTVHAPPRAESDAEWAKVC
FT                   DVSEMFASVAEAEGWLDDGGDAFDRSAFETNRRPRLPSPQYARLLLRAREAPLALPAVA
FT                   NGGGGRGEKRTALPAAGVGEGSSGGGGGGCWPTEPAKFPADSLRVGAAVEVRRRASSGA
FT                   DSRGADSGAAGGWRPGTVQSLVSAFNFRVRVCFDEPVRGAPRCVWLVCENDGEFPALRL
FT                   DGEGASAAGCHEFPSQSLGFEGASGVFELRPAQSGWKDGVVGEAEVAMTRRGGWVPAFV
FT                   DKGGAWIKLGVRGEGERSNVPPGTIRSRPRMAWIGEGCAHGAWRKATDSDYSGYKLSDF
FT                   TFPEDEEDDEEDEDEEGEEDKEGEEDPVAPKPEPTVAKVTIPKETDVVEKEELPDAAPV
FT                   AVAHRPAASATGKTRGRKPGEHFAAAYANELRASAKAAAAKTAAECGANDAPVKAVEAV
FT                   FTAAKVGDDVFAAVNDVTKANKSRRNAGLKDIALRVCDAFLAARAGAGITRLYPQGKHL
FT                   DKNDDKPLLEKVEKLVWEKVAPRVQKNKDKVRKELKPPTQNGYQLEIRENITQADDNDE
FT                   EEDVPIARRARAARARPILPADEDEDEEDDEDDPDASNASSSDDDEEDDDEPKPKRQRG
FT                   RRASITAASSADPASAAAAARRAAAAAALSVAWSPRLDRRPDEPPASVLAVGCKSGAVT
FT                   LWLVRRPATAGDGGAVDVEAMGRFRACDGCATSLAWTGDVRLGESPPGESPQNGESPQN
FT                   GESSPGESPGGGGFALVVGGSDGSVRTFTVSRKSLLAAAGAEGGRRGRRATRAVPLTPG
FT                   AELSPADGDPVTRVAVADSVKIDSDNRAHARPVIAAGKASGTVAAWRLAAHDSTSAEAT
FT                   WSARCHVQPVSGLAWCAAPEIENCAAVRLVSMHTTGAAVAYTVPTDPRARHDDWTLTDA
FT                   CVEDLTVASIDGLDLNGNTAGGGAKLPVSSHAGLASSPAGVLVATAAGFVASTYASGAT
FT                   MIQSRARRGRVAVAPPAALAAGRVKSHSMTEISGDAASGKLDDGAADESLSVACAARRL
FT                   PFLASDRGVSLWDVRAAAKHAGAGGARALESAAGEMQSTGGARASQLAKSLLCGAPEMF
FT                   VGFEPLSCEGCGRGYPRGEGWPGCGDCGLLLRPEDVTRAALSRAMI"
     MPWERVLRET PSPYPGAVAW SHENLIAVGQ ERSVCILNPA DIDGPAGCVS LVDDARAKPA        60
     NANDEDADDH GDDGDGGVPF PELTRPRRST SLLSTRVVIH PNHRPEVVAR DLAWSPLGLA       120
     PPAVSPSGIL GDGCLLAIAS SAHRVTVHAP PRAESDAEWA KVCDVSEMFA SVAEAEGWLD       180
     DGGDAFDRSA FETNRRPRLP SPQYARLLLR AREAPLALPA VANGGGGRGE KRTALPAAGV       240
     GEGSSGGGGG GCWPTEPAKF PADSLRVGAA VEVRRRASSG ADSRGADSGA AGGWRPGTVQ       300
     SLVSAFNFRV RVCFDEPVRG APRCVWLVCE NDGEFPALRL DGEGASAAGC HEFPSQSLGF       360
     EGASGVFELR PAQSGWKDGV VGEAEVAMTR RGGWVPAFVD KGGAWIKLGV RGEGERSNVP       420
     PGTIRSRPRM AWIGEGCAHG AWRKATDSDY SGYKLSDFTF PEDEEDDEED EDEEGEEDKE       480
     GEEDPVAPKP EPTVAKVTIP KETDVVEKEE LPDAAPVAVA HRPAASATGK TRGRKPGEHF       540
     AAAYANELRA SAKAAAAKTA AECGANDAPV KAVEAVFTAA KVGDDVFAAV NDVTKANKSR       600
     RNAGLKDIAL RVCDAFLAAR AGAGITRLYP QGKHLDKNDD KPLLEKVEKL VWEKVAPRVQ       660
     KNKDKVRKEL KPPTQNGYQL EIRENITQAD DNDEEEDVPI ARRARAARAR PILPADEDED       720
     EEDDEDDPDA SNASSSDDDE EDDDEPKPKR QRGRRASITA ASSADPASAA AAARRAAAAA       780
     ALSVAWSPRL DRRPDEPPAS VLAVGCKSGA VTLWLVRRPA TAGDGGAVDV EAMGRFRACD       840
     GCATSLAWTG DVRLGESPPG ESPQNGESPQ NGESSPGESP GGGGFALVVG GSDGSVRTFT       900
     VSRKSLLAAA GAEGGRRGRR ATRAVPLTPG AELSPADGDP VTRVAVADSV KIDSDNRAHA       960
     RPVIAAGKAS GTVAAWRLAA HDSTSAEATW SARCHVQPVS GLAWCAAPEI ENCAAVRLVS      1020
     MHTTGAAVAY TVPTDPRARH DDWTLTDACV EDLTVASIDG LDLNGNTAGG GAKLPVSSHA      1080
     GLASSPAGVL VATAAGFVAS TYASGATMIQ SRARRGRVAV APPAALAAGR VKSHSMTEIS      1140
     GDAASGKLDD GAADESLSVA CAARRLPFLA SDRGVSLWDV RAAAKHAGAG GARALESAAG      1200
     EMQSTGGARA SQLAKSLLCG APEMFVGFEP LSCEGCGRGY PRGEGWPGCG DCGLLLRPED      1260
     VTRAALSRAM I                                                           1271
//

If you have problems or comments...

PBIL Back to PBIL home page