(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE379

MICSR_1.PE379        Location/Qualifiers
FT   CDS             740045..>740311
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637009"
FT                   /orf_name="MICPUN_74510"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61781.1"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniParc:UPI000199A91B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q6"
FT                   /transl_table=1
FT                   /translation="MASAIRAWINSPTGPKTTHFWGPVANWGFVLAGLNDTKKPEEQIS
FT                   GPMTGALTVYSGLFMRFAWRVQPRNFILLACHTANASVQVRALS"
     MASAIRAWIN SPTGPKTTHF WGPVANWGFV LAGLNDTKKP EEQISGPMTG ALTVYSGLFM        60
     RFAWRVQPRN FILLACHTAN ASVQVRALS                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page