(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE38

MICSR_1.PE38         Location/Qualifiers
FT   CDS             complement(78458..79255)
FT                   /codon_start=1
FT                   /gene_family="HOG000100016" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636043"
FT                   /orf_name="MICPUN_56611"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62048.1"
FT                   /db_xref="HOGENOM:HBG560174"
FT                   /db_xref="UniParc:UPI000199AB2D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R5"
FT                   /transl_table=1
FT                   /translation="MMDNKVHISDGTTGRMPSAKSNKNHLFGHAIAEDLVRRYFSRSLD
FT                   KKDKVGLAAFGMHVLCHPPERRVLKLCYLCELMAVIAGLVMFFSSYLLRFDATSTFGIM
FT                   GAFFANVSLMCNLCGIINCLFMGFKISTGKGSVYEALDVLQGVGQTVNLIVFGVNGAGM
FT                   AYMFYSLDLTTDDYLRWANLGIFIPAFCYSYGFVIWYVLSYEPLSWWHQWSWNYELFKP
FT                   MYIIAWLRMGRVPMRERAAAQLEYLLADLPDDVMAILKADGNV"
     MMDNKVHISD GTTGRMPSAK SNKNHLFGHA IAEDLVRRYF SRSLDKKDKV GLAAFGMHVL        60
     CHPPERRVLK LCYLCELMAV IAGLVMFFSS YLLRFDATST FGIMGAFFAN VSLMCNLCGI       120
     INCLFMGFKI STGKGSVYEA LDVLQGVGQT VNLIVFGVNG AGMAYMFYSL DLTTDDYLRW       180
     ANLGIFIPAF CYSYGFVIWY VLSYEPLSWW HQWSWNYELF KPMYIIAWLR MGRVPMRERA       240
     AAQLEYLLAD LPDDVMAILK ADGNV                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page