(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE380

MICSR_1.PE380        Location/Qualifiers
FT   CDS             741564..742499
FT                   /codon_start=1
FT                   /gene_family="HOG000030427" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637010"
FT                   /orf_name="MICPUN_97151"
FT                   /product="Predicted protein"
FT                   /function="aminopeptidase activity"
FT                   /function="metalloexopeptidase activity"
FT                   /biological_process="cellular process"
FT                   /biological_process="proteolysis"
FT                   /protein_id="ACO61782.1"
FT                   /db_xref="GO:0004177"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008235"
FT                   /db_xref="GO:0009987"
FT                   /db_xref="HOGENOM:HBG299384"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="UniParc:UPI000199A91C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q7"
FT                   /transl_table=1
FT                   /translation="MPEFKWTGPLRPMKVSPKRSVPKIGWLCPLPDYARTGWPEAEFAS
FT                   SLQHKLEVKTPEQLAKMRAACSLGRAVMDAVAAAIKPGVTTDQLDRICHAMTLMNGAYP
FT                   SPRNYMGFPKSLCTSVNEVVCHGIPDARPLEDGDIVNLDITVCLDGYHGDLNETYFVGT
FT                   GSSDPERAERAKALMKCALECLELAMARCTPGARFRDLGEAIQTHANGRGYGVVKDFCG
FT                   HGIGALFHCAPNVPHYAKNKAVGVMKPGMTFTIEPMVNEGTHRTKHWPDGWTAVTADGG
FT                   RSAQYEHTMAVTETGLDVLTKRTANSRPFY"
     MPEFKWTGPL RPMKVSPKRS VPKIGWLCPL PDYARTGWPE AEFASSLQHK LEVKTPEQLA        60
     KMRAACSLGR AVMDAVAAAI KPGVTTDQLD RICHAMTLMN GAYPSPRNYM GFPKSLCTSV       120
     NEVVCHGIPD ARPLEDGDIV NLDITVCLDG YHGDLNETYF VGTGSSDPER AERAKALMKC       180
     ALECLELAMA RCTPGARFRD LGEAIQTHAN GRGYGVVKDF CGHGIGALFH CAPNVPHYAK       240
     NKAVGVMKPG MTFTIEPMVN EGTHRTKHWP DGWTAVTADG GRSAQYEHTM AVTETGLDVL       300
     TKRTANSRPF Y                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page