(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE381

MICSR_1.PE381        Location/Qualifiers
FT   CDS             complement(742671..743453)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637011"
FT                   /orf_name="MICPUN_107914"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62211.1"
FT                   /db_xref="UniParc:UPI000199A91D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q8"
FT                   /transl_table=1
FT                   /translation="MALPQCLSKDKASKLRGQENMAINSSAYQFFGTLFNVIGLAMGIV
FT                   GSLMYSPTVLHAMFGADMNENREWEWMRNWANIIWAVSFFMFPIGVGMFLVERWECISA
FT                   HNEAVGKPPPSPWDKNMRILVWAEIMLGICAAGGVFFCFDDDPGAYFIACALFTLAGGI
FT                   KVSLLVYEICEMSGCCCGTGVFDEEHGMPAKGADEKTPLLNDGDGYPVGGGNWKGEQGS
FT                   AGKGRRDSTGSPQGSDIAPSSDTSSLLGDPHVAQGSPR"
     MALPQCLSKD KASKLRGQEN MAINSSAYQF FGTLFNVIGL AMGIVGSLMY SPTVLHAMFG        60
     ADMNENREWE WMRNWANIIW AVSFFMFPIG VGMFLVERWE CISAHNEAVG KPPPSPWDKN       120
     MRILVWAEIM LGICAAGGVF FCFDDDPGAY FIACALFTLA GGIKVSLLVY EICEMSGCCC       180
     GTGVFDEEHG MPAKGADEKT PLLNDGDGYP VGGGNWKGEQ GSAGKGRRDS TGSPQGSDIA       240
     PSSDTSSLLG DPHVAQGSPR                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page