(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE382

MICSR_1.PE382        Location/Qualifiers
FT   CDS             744189..746138
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637012"
FT                   /orf_name="MICPUN_56961"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61783.1"
FT                   /db_xref="InterPro:IPR021897"
FT                   /db_xref="UniParc:UPI000199A91E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q9"
FT                   /transl_table=1
FT                   /translation="MDDRSRETAVDVVRRCREAGIELDPVLAAYHCAALRYQGVPWDDA
FT                   FTQTAAERIVAPRSRLAVDTMAMQVAADEIRATMTAAIAADRRDREERAAAYEREVLTV
FT                   AASFPRMTQREQADFMEHMWKNVFFRYVCVKGGMESALGINDEVGREETFAAFKSVFPK
FT                   HETTRFLTQTAPEISAQLRELASIVLGIRVFNRRMEELSRGGNGPSPSGSVPDPAPGYL
FT                   NLGAKMREDLAGRAHSAARLCAQYRCVSSHQSLRRDPGDELLTRLADENNNRVAYWSII
FT                   RALIEDNAEGIERVDELTRRVHDGCEEVRELIEDAEGLTEGLGGGVRRDELYPILQSVG
FT                   ANHSALLDEAAAQEVIHAVSARMTDFSKPFETSLTNELLHEGIRVEKMAKERYGPHAVV
FT                   GVPKVDDAKDVPKTVVEPHLSRKLGESGAEITHGGVTTLEYGGYDVFALCKRRGLALPA
FT                   SMSAPDTAVVFQGKTYGFADEYAAKQFASQPAKYVRAMHATLFRMPELVRITHPSGEAT
FT                   ARAFPNLDVAKLAAGMSVPSPTEFGTQTDTHPVERHVDKDYEWNEWALRRRALHAANLL
FT                   RKATHGSQTHSSHFRRENTTQVWLPKRNETQTVVTKGTTMPQKKRYIGGMRGAPDVKLN
FT                   VVNVELDLGQPYEH"
     MDDRSRETAV DVVRRCREAG IELDPVLAAY HCAALRYQGV PWDDAFTQTA AERIVAPRSR        60
     LAVDTMAMQV AADEIRATMT AAIAADRRDR EERAAAYERE VLTVAASFPR MTQREQADFM       120
     EHMWKNVFFR YVCVKGGMES ALGINDEVGR EETFAAFKSV FPKHETTRFL TQTAPEISAQ       180
     LRELASIVLG IRVFNRRMEE LSRGGNGPSP SGSVPDPAPG YLNLGAKMRE DLAGRAHSAA       240
     RLCAQYRCVS SHQSLRRDPG DELLTRLADE NNNRVAYWSI IRALIEDNAE GIERVDELTR       300
     RVHDGCEEVR ELIEDAEGLT EGLGGGVRRD ELYPILQSVG ANHSALLDEA AAQEVIHAVS       360
     ARMTDFSKPF ETSLTNELLH EGIRVEKMAK ERYGPHAVVG VPKVDDAKDV PKTVVEPHLS       420
     RKLGESGAEI THGGVTTLEY GGYDVFALCK RRGLALPASM SAPDTAVVFQ GKTYGFADEY       480
     AAKQFASQPA KYVRAMHATL FRMPELVRIT HPSGEATARA FPNLDVAKLA AGMSVPSPTE       540
     FGTQTDTHPV ERHVDKDYEW NEWALRRRAL HAANLLRKAT HGSQTHSSHF RRENTTQVWL       600
     PKRNETQTVV TKGTTMPQKK RYIGGMRGAP DVKLNVVNVE LDLGQPYEH                   649
//

If you have problems or comments...

PBIL Back to PBIL home page