(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE384

MICSR_1.PE384        Location/Qualifiers
FT   CDS             747474..>748358
FT                   /codon_start=1
FT                   /gene_family="HOG000030425" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637014"
FT                   /orf_name="MICPUN_79723"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61784.1"
FT                   /db_xref="HOGENOM:HBG318431"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="UniParc:UPI000199A920"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R1"
FT                   /transl_table=1
FT                   /translation="MSSTWNKLVNLVIRPPRAQYDPNEHLPGPRFRIAGVTHVRRDIDL
FT                   AGADGLTLKCSHYEPEVRGNDPLPCVIYLHGNSGSRCDATEAIRLLLPARITVFAVDLG
FT                   GSGMSEGEYVTLGVRETKDVECIVNHLRDQGLTSKIGLWGTSMGAVTAIMYANRDPSIA
FT                   GVVLDSPFSSLPKLMLELVAQFTKGSRVGVPKMAARMALSFVRSSVKSRAKFDINDLDL
FT                   RKVAPSTFCPALFAHGKDDDFIPPHHSETLHELYAGDKNYIAIDGDHNSPRPAFFFDST
FT                   VIFFCNVLDPPPTS"
     MSSTWNKLVN LVIRPPRAQY DPNEHLPGPR FRIAGVTHVR RDIDLAGADG LTLKCSHYEP        60
     EVRGNDPLPC VIYLHGNSGS RCDATEAIRL LLPARITVFA VDLGGSGMSE GEYVTLGVRE       120
     TKDVECIVNH LRDQGLTSKI GLWGTSMGAV TAIMYANRDP SIAGVVLDSP FSSLPKLMLE       180
     LVAQFTKGSR VGVPKMAARM ALSFVRSSVK SRAKFDINDL DLRKVAPSTF CPALFAHGKD       240
     DDFIPPHHSE TLHELYAGDK NYIAIDGDHN SPRPAFFFDS TVIFFCNVLD PPPTS            295
//

If you have problems or comments...

PBIL Back to PBIL home page