(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE386

MICSR_1.PE386        Location/Qualifiers
FT   CDS             join(complement(751489..751641),c
FT                   omplement(<751351..751455))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637016"
FT                   /orf_name="MICPUN_80332"
FT                   /product="Predicted protein"
FT                   /function="hydrogen-translocating pyrophosphatase activity "
FT                   /function="inorganic diphosphatase activity"
FT                   /biological_process="proton transport"
FT                   /cellular_component="membrane"
FT                   /protein_id="ACO62214.1"
FT                   /db_xref="GO:0004427"
FT                   /db_xref="GO:0009678"
FT                   /db_xref="GO:0015992"
FT                   /db_xref="GO:0016020"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniParc:UPI000199A989"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R3"
FT                   /transl_table=1
FT                   /translation="MADAGEAEADSYQKLRQIYRDIQAGAKAFLAAEYRMCLAFLAVFG
FT                   VAMIFFIGTLTAFSFFVGGITSMVSGYIGMMIAVFTNARCT"
     MADAGEAEAD SYQKLRQIYR DIQAGAKAFL AAEYRMCLAF LAVFGVAMIF FIGTLTAFSF        60
     FVGGITSMVS GYIGMMIAVF TNARCT                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page