(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE387

MICSR_1.PE387        Location/Qualifiers
FT   CDS             752397..753743
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637017"
FT                   /orf_name="MICPUN_99477"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61785.1"
FT                   /db_xref="UniParc:UPI000199A98A"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R4"
FT                   /transl_table=1
FT                   /translation="MRRQAEERRAVVLTNTEKDMLKELSEARKGTWNNTLEAQRKQREA
FT                   AKAQRLEDEEEAKCVLDREEASIRATQRQAQIMRANKMLYDQTDRVKSFNSSLLLSDVL
FT                   QERDLQIDLKKRVEEVRDRHEAAFVKEQEKAWEVADYAEAAKASERKQAAMQQRDAQLL
FT                   QIEQFKEQILAEMREDRRDGELIRRRAAEEEEEERLRELRRREEAMRGAMETAKANAAL
FT                   KEYKAGEAAAEAAMDRKIEQFARAKERMDAARRVHAEAKNREKAAVRDAMVARMEADLI
FT                   ARQKKAVEAEDNAAERAEAEREAAEALKAAERLEDLRVIELSRQQQLAIKAAERERERE
FT                   REELFVRQWAQRNEQLQREEEEEKLETFARNKRLQQAHVRQIARKIKKANAERELDLRA
FT                   SLAATRRLEEEDELFDHYARVCMDEWESRGKSLRPMMVELGKFDPNRVT"
     MRRQAEERRA VVLTNTEKDM LKELSEARKG TWNNTLEAQR KQREAAKAQR LEDEEEAKCV        60
     LDREEASIRA TQRQAQIMRA NKMLYDQTDR VKSFNSSLLL SDVLQERDLQ IDLKKRVEEV       120
     RDRHEAAFVK EQEKAWEVAD YAEAAKASER KQAAMQQRDA QLLQIEQFKE QILAEMREDR       180
     RDGELIRRRA AEEEEEERLR ELRRREEAMR GAMETAKANA ALKEYKAGEA AAEAAMDRKI       240
     EQFARAKERM DAARRVHAEA KNREKAAVRD AMVARMEADL IARQKKAVEA EDNAAERAEA       300
     EREAAEALKA AERLEDLRVI ELSRQQQLAI KAAERERERE REELFVRQWA QRNEQLQREE       360
     EEEKLETFAR NKRLQQAHVR QIARKIKKAN AERELDLRAS LAATRRLEEE DELFDHYARV       420
     CMDEWESRGK SLRPMMVELG KFDPNRVT                                          448
//

If you have problems or comments...

PBIL Back to PBIL home page