(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE388

MICSR_1.PE388        Location/Qualifiers
FT   CDS             join(754190..754322,754463..755478)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637018"
FT                   /orf_name="MICPUN_56966"
FT                   /product="Predicted protein"
FT                   /function="transcription regulator activity"
FT                   /cellular_component="nucleus"
FT                   /protein_id="ACO61786.1"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0030528"
FT                   /db_xref="InterPro:IPR001092"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="UniParc:UPI000199A98B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R5"
FT                   /transl_table=1
FT                   /translation="MDDHPGGLAPLFDDAGKDRTYTDTELQELLSFVENMDNATSADEL
FT                   AGGLNHVGLGLAPANAGLSHPVPHAPVLPMRFNEQGISLQFQPGPTSARGRGRGGRGGG
FT                   RGAAPAVGNFEAPMSASPAIEDDGSQRVSHGASEKQRRDRINAMIDELRMLVPGQAGGG
FT                   EGRRSKYIVLQDTINMIAALKAKCQAQERELVALRAAGASEGASGGVQTQDQQQQMMML
FT                   MGQDGQGLDPVREESIRNPANGTNSTLNSGQTISVAVEMGEEICYVKIKAPDRQGLLQD
FT                   ILNALHALPMTVQRAVVTTDSENGVVFVTDIFELKINTAIPVEQRISPEDVKTHIHQSM
FT                   HASFLAYENPELYARKRKGTQGGVSGSDSGGSGIGSGVRAAG"
     MDDHPGGLAP LFDDAGKDRT YTDTELQELL SFVENMDNAT SADELAGGLN HVGLGLAPAN        60
     AGLSHPVPHA PVLPMRFNEQ GISLQFQPGP TSARGRGRGG RGGGRGAAPA VGNFEAPMSA       120
     SPAIEDDGSQ RVSHGASEKQ RRDRINAMID ELRMLVPGQA GGGEGRRSKY IVLQDTINMI       180
     AALKAKCQAQ ERELVALRAA GASEGASGGV QTQDQQQQMM MLMGQDGQGL DPVREESIRN       240
     PANGTNSTLN SGQTISVAVE MGEEICYVKI KAPDRQGLLQ DILNALHALP MTVQRAVVTT       300
     DSENGVVFVT DIFELKINTA IPVEQRISPE DVKTHIHQSM HASFLAYENP ELYARKRKGT       360
     QGGVSGSDSG GSGIGSGVRA AG                                                382
//

If you have problems or comments...

PBIL Back to PBIL home page