(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE389

MICSR_1.PE389        Location/Qualifiers
FT   CDS             complement(<755725..>756288)
FT                   /codon_start=1
FT                   /gene_family="HOG000242591" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637019"
FT                   /orf_name="MICPUN_72375"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62215.1"
FT                   /db_xref="HOGENOM:HBG317622"
FT                   /db_xref="InterPro:IPR008501"
FT                   /db_xref="InterPro:IPR018018"
FT                   /db_xref="UniParc:UPI000199A98C"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R6"
FT                   /transl_table=1
FT                   /translation="EEALIKKRLLTQTTTARPGADPPVKKLTKKYVAYVNALAEDDANG
FT                   DGADAERAREAWLKEIALYEFNMGRYRAVASANAREMEQYASASAAVDGEVRGTKDEIA
FT                   ELKTDLDGARLDRQHKEEYEALRRLCTQFPSRSDTTARLASLEAEIAELETESEATASK
FT                   LDLRKKQFALLLHLVNELQGELAEE"
     EEALIKKRLL TQTTTARPGA DPPVKKLTKK YVAYVNALAE DDANGDGADA ERAREAWLKE        60
     IALYEFNMGR YRAVASANAR EMEQYASASA AVDGEVRGTK DEIAELKTDL DGARLDRQHK       120
     EEYEALRRLC TQFPSRSDTT ARLASLEAEI AELETESEAT ASKLDLRKKQ FALLLHLVNE       180
     LQGELAEE                                                                188
//

If you have problems or comments...

PBIL Back to PBIL home page