(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE39

MICSR_1.PE39         Location/Qualifiers
FT   CDS             79459..79935
FT                   /codon_start=1
FT                   /gene_family="HOG000029296" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636044"
FT                   /orf_name="MICPUN_107856"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61603.1"
FT                   /db_xref="HOGENOM:HBG638995"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniParc:UPI000199AB2E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R6"
FT                   /transl_table=1
FT                   /translation="MNRRDEPGASTSSSSTLVALVDGDCALCSGYARLVSALDGKGAVY
FT                   FETQQSDAGRALLKRCGMPTDLSSIVVVEVSPKGKAVGYVRSTAVLRTFLALGAPWSAL
FT                   YLTVAIPEFIRDGVYGLVAKHRYSVFGTNGGRCALPDAVTRRRIGRVLPAGLLD"
     MNRRDEPGAS TSSSSTLVAL VDGDCALCSG YARLVSALDG KGAVYFETQQ SDAGRALLKR        60
     CGMPTDLSSI VVVEVSPKGK AVGYVRSTAV LRTFLALGAP WSALYLTVAI PEFIRDGVYG       120
     LVAKHRYSVF GTNGGRCALP DAVTRRRIGR VLPAGLLD                               158
//

If you have problems or comments...

PBIL Back to PBIL home page