(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE390

MICSR_1.PE390        Location/Qualifiers
FT   CDS             756876..758516
FT                   /codon_start=1
FT                   /gene_family="HOG000040008" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637020"
FT                   /orf_name="MICPUN_93687"
FT                   /product="Phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO61787.1"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="HOGENOM:HBG287074"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniParc:UPI000199A98D"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R7"
FT                   /transl_table=1
FT                   /translation="MVTTQFIPHATAAEDGTPVLVTTTTPAILKKLQNGSDVRGVALEG
FT                   VPGEPVTLNEEAAYLIGAAFVDWLADKKGKKPSELSIAVGRDPRLSGPALANAMFAGFG
FT                   SKDVGRVVDMGIATTPACFMATVTPGVAYDAGIMLTASHLPFNRNGAKFFTSDGGLDKA
FT                   DIKRICEDAAAACQAAPDGHAIPLDGDDAVESVPFLEDYAAQLRDLIKKGANHPTAYDE
FT                   PLTGMKIIVDAGNGSGGFFAKSVLEPLGADVYGSQFLDPDGKFPNHSPNPEDAEAMDSA
FT                   VEATVKAKADLGVIFDTDVDRSAVIDGDGNPINRNKLIALLAAIILDEHPGSTVVTDSV
FT                   TSDGLAEFIEGKGGKHVRYMRGYKNVINEGVRRDKAGEPCHLMIETSGHGAMKENYCLD
FT                   DGAYIAVKIIIEAVRRRLSGGKGISDLLSELREPLEEKEVRLKITCDDFKAYGGDVLEQ
FT                   LKEAVGSMKGYTPVDVNYEGYRVNRDEGDGKRGWFLLRQSLHDPVMVLNFESEIPGGVD
FT                   AMAKDVVAWLKEKDFASLDASAVYAILDK"
     MVTTQFIPHA TAAEDGTPVL VTTTTPAILK KLQNGSDVRG VALEGVPGEP VTLNEEAAYL        60
     IGAAFVDWLA DKKGKKPSEL SIAVGRDPRL SGPALANAMF AGFGSKDVGR VVDMGIATTP       120
     ACFMATVTPG VAYDAGIMLT ASHLPFNRNG AKFFTSDGGL DKADIKRICE DAAAACQAAP       180
     DGHAIPLDGD DAVESVPFLE DYAAQLRDLI KKGANHPTAY DEPLTGMKII VDAGNGSGGF       240
     FAKSVLEPLG ADVYGSQFLD PDGKFPNHSP NPEDAEAMDS AVEATVKAKA DLGVIFDTDV       300
     DRSAVIDGDG NPINRNKLIA LLAAIILDEH PGSTVVTDSV TSDGLAEFIE GKGGKHVRYM       360
     RGYKNVINEG VRRDKAGEPC HLMIETSGHG AMKENYCLDD GAYIAVKIII EAVRRRLSGG       420
     KGISDLLSEL REPLEEKEVR LKITCDDFKA YGGDVLEQLK EAVGSMKGYT PVDVNYEGYR       480
     VNRDEGDGKR GWFLLRQSLH DPVMVLNFES EIPGGVDAMA KDVVAWLKEK DFASLDASAV       540
     YAILDK                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page