(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE391

MICSR_1.PE391        Location/Qualifiers
FT   CDS             join(complement(759279..759330),complement(759082..759155),
FT                   complement(<758643..758957))
FT                   /codon_start=1
FT                   /gene_family="HOG000216624" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637021"
FT                   /orf_name="MICPUN_90249"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62216.1"
FT                   /db_xref="HOGENOM:HBG499888"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="UniParc:UPI000199A98E"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R8"
FT                   /transl_table=1
FT                   /translation="MLIPKKNRKEVYKYLFREGVIYAKKDFNLPAHPEIKEVPNLQVIK
FT                   LMQSFTSKELVKEQFSWRYYYWYLTNEGIEYLREYLNLSADVVPNTLKKSTRPPTRPMA
FT                   DERAPRGDRGPRGGREGYRSERPGGFGRGGDKAGPGGNFNPQF"
     MLIPKKNRKE VYKYLFREGV IYAKKDFNLP AHPEIKEVPN LQVIKLMQSF TSKELVKEQF        60
     SWRYYYWYLT NEGIEYLREY LNLSADVVPN TLKKSTRPPT RPMADERAPR GDRGPRGGRE       120
     GYRSERPGGF GRGGDKAGPG GNFNPQF                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page