(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE392

MICSR_1.PE392        Location/Qualifiers
FT   CDS             complement(759802..760710)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637022"
FT                   /orf_name="MICPUN_107917"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62217.1"
FT                   /db_xref="UniParc:UPI000199A98F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R9"
FT                   /transl_table=1
FT                   /translation="MIGTSPVLVLYLAYTVMAGAFTLKLSSDCASSAPAPGVLEPPSPP
FT                   PPPSPPPGTAYVSSGETNYWEMASAVALGVAMISMSCTSFAAVYYMEDTVENKRKECEA
FT                   FPVDEEVEAREKKVQAKKHAYKAVTSWNALPKLDKCLLGASLFLMTLACHIAGNFGSLC
FT                   FATFSVTCSVALADVVLPLGWVAIGLFTAGCLTFYFYGKGASRRARKVLEAESNADMVT
FT                   ADAVTEIGGAIESGGRRGRGAVNAVEPAGTTAQDPARLPGAVTEQVTRAANWSDDETPP
FT                   GSVSSYGEEEDVEEGKPWDRM"
     MIGTSPVLVL YLAYTVMAGA FTLKLSSDCA SSAPAPGVLE PPSPPPPPSP PPGTAYVSSG        60
     ETNYWEMASA VALGVAMISM SCTSFAAVYY MEDTVENKRK ECEAFPVDEE VEAREKKVQA       120
     KKHAYKAVTS WNALPKLDKC LLGASLFLMT LACHIAGNFG SLCFATFSVT CSVALADVVL       180
     PLGWVAIGLF TAGCLTFYFY GKGASRRARK VLEAESNADM VTADAVTEIG GAIESGGRRG       240
     RGAVNAVEPA GTTAQDPARL PGAVTEQVTR AANWSDDETP PGSVSSYGEE EDVEEGKPWD       300
     RM                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page