(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE393

MICSR_1.PE393        Location/Qualifiers
FT   CDS             763187..764254
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637023"
FT                   /orf_name="MICPUN_99481"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61788.1"
FT                   /db_xref="HOGENOM:HBG560181"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="UniParc:UPI000199A990"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S0"
FT                   /transl_table=1
FT                   /translation="MGDENDAVADEGDWYAALVAGEHVGDWLDTVRNAKIPPGRRTRAA
FT                   RQLAEKVAADRTYADEAREGDAADVCEAAARDIPEGDDDERLVAMREAFESCAAACRAA
FT                   AQDGGARERSFSFEGGREVVVREIALGVGVGAKVWRAAIMLGDELAANPGWCEGKRCLE
FT                   IGAGVGLCGLLASKLGAASVTLTDFERPLLDSLVLAVDRNRELDARDAVGTTTTALTLV
FT                   RRLDWIEECERPHATGGDADDPKKPTDFASGENGWKEMDHNSTFDFVFGSDLLYEEVHA
FT                   LTLPGVIKRRVASPSGRCRIVGAVRNRAMLDALVENMRKEGLAVVETHLRDNDTNAADW
FT                   YEDGYCALEVTHDVE"
     MGDENDAVAD EGDWYAALVA GEHVGDWLDT VRNAKIPPGR RTRAARQLAE KVAADRTYAD        60
     EAREGDAADV CEAAARDIPE GDDDERLVAM REAFESCAAA CRAAAQDGGA RERSFSFEGG       120
     REVVVREIAL GVGVGAKVWR AAIMLGDELA ANPGWCEGKR CLEIGAGVGL CGLLASKLGA       180
     ASVTLTDFER PLLDSLVLAV DRNRELDARD AVGTTTTALT LVRRLDWIEE CERPHATGGD       240
     ADDPKKPTDF ASGENGWKEM DHNSTFDFVF GSDLLYEEVH ALTLPGVIKR RVASPSGRCR       300
     IVGAVRNRAM LDALVENMRK EGLAVVETHL RDNDTNAADW YEDGYCALEV THDVE            355
//

If you have problems or comments...

PBIL Back to PBIL home page