(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE394

MICSR_1.PE394        Location/Qualifiers
FT   CDS             complement(764340..765656)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637024"
FT                   /orf_name="MICPUN_56972"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62218.1"
FT                   /db_xref="UniParc:UPI000199A991"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S1"
FT                   /transl_table=1
FT                   /translation="MAVKDELSPIVVNAWLPHKPLPGEDEEAIDKKPIDQILRGIPYRL
FT                   VNSAPKKKIVELKAALEAERAKIKEAGEGEELSEEQTATNAAAEEAIAPMEEELAAAEA
FT                   AYEELTGILCKGQLSTLPWIDSLMRYVDLGGSCIVPGGAVAADDAFRSVNGNLTDVNGM
FT                   LTEKQLAESKAWAEYITQAKLEKPGGYTIVCKYAPNPYLSAQAAIDAFPAWVERQITLG
FT                   FGVELEEGADPILPHVMLAWPDPSVPGVAEVIAKMLGPLTEDAEEGKVKAVSLDLSGDV
FT                   SCDPRPLRECLERGGTSKPSGVVVPGIHALDKVGAQLVADATRSDVKVIAGDALLGGLV
FT                   SERYLRVPAPTLAELKGTAAFAGLARVLASPGGWDGFQATLEALEATGRGVATALVQAF
FT                   ADAGMKVEIETELEKGPAFEIGEPLGEEHTAAIVAAMSA"
     MAVKDELSPI VVNAWLPHKP LPGEDEEAID KKPIDQILRG IPYRLVNSAP KKKIVELKAA        60
     LEAERAKIKE AGEGEELSEE QTATNAAAEE AIAPMEEELA AAEAAYEELT GILCKGQLST       120
     LPWIDSLMRY VDLGGSCIVP GGAVAADDAF RSVNGNLTDV NGMLTEKQLA ESKAWAEYIT       180
     QAKLEKPGGY TIVCKYAPNP YLSAQAAIDA FPAWVERQIT LGFGVELEEG ADPILPHVML       240
     AWPDPSVPGV AEVIAKMLGP LTEDAEEGKV KAVSLDLSGD VSCDPRPLRE CLERGGTSKP       300
     SGVVVPGIHA LDKVGAQLVA DATRSDVKVI AGDALLGGLV SERYLRVPAP TLAELKGTAA       360
     FAGLARVLAS PGGWDGFQAT LEALEATGRG VATALVQAFA DAGMKVEIET ELEKGPAFEI       420
     GEPLGEEHTA AIVAAMSA                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page