(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE395

MICSR_1.PE395        Location/Qualifiers
FT   CDS             join(765945..766061,766272..766829)
FT                   /codon_start=1
FT                   /gene_family="HOG000264301" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637025"
FT                   /gene_name="SSRbeta"
FT                   /orf_name="MICPUN_112669"
FT                   /product="Translocon-associated complex trap beta subunit "
FT                   /cellular_component="endoplasmic reticulum"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO61789.1"
FT                   /db_xref="GO:0005783"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="HOGENOM:HBG608371"
FT                   /db_xref="InterPro:IPR008856"
FT                   /db_xref="UniParc:UPI000199A992"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S2"
FT                   /transl_table=1
FT                   /translation="MFPRTAVRATLVALFVAAALFQGVVADNAPTSAHLIVHKLIIGRN
FT                   MTIEITLYNAGETAATGVEINDPGWDSSSFAMLGPSTSAKFASIPPLTKKTHRFVVVPK
FT                   VTGQFSAGPSLVSYTAGAGHQASGTSNALDPLPILTPWEAKVEVAMKIGSYLTLGFCNN
FT                   AEEWTKAAIITTVLVGLITVNWIALKGKRAVAEAQRKQAMKSLGINPKDVAVSKKQKQK
FT                   KK"
     MFPRTAVRAT LVALFVAAAL FQGVVADNAP TSAHLIVHKL IIGRNMTIEI TLYNAGETAA        60
     TGVEINDPGW DSSSFAMLGP STSAKFASIP PLTKKTHRFV VVPKVTGQFS AGPSLVSYTA       120
     GAGHQASGTS NALDPLPILT PWEAKVEVAM KIGSYLTLGF CNNAEEWTKA AIITTVLVGL       180
     ITVNWIALKG KRAVAEAQRK QAMKSLGINP KDVAVSKKQK QKKK                        224
//

If you have problems or comments...

PBIL Back to PBIL home page