(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE396

MICSR_1.PE396        Location/Qualifiers
FT   CDS             767031..767714
FT                   /codon_start=1
FT                   /gene_family="HOG000264300" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637026"
FT                   /orf_name="MICPUN_56974"
FT                   /product="Putative uncharacterized protein "
FT                   /protein_id="ACO61790.1"
FT                   /db_xref="InterPro:IPR019258"
FT                   /db_xref="UniParc:UPI000199A993"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S3"
FT                   /transl_table=1
FT                   /translation="MATDEEVAWCAELRRAVTSLQDSIDAARSFDHVRLPADGPVSAAD
FT                   VVEYARRISYTTFAPAGYQPGAPLHGIMPPAPQDEHFAASHLAAHAAQARQREEARRAR
FT                   EKAAEEARKAASRGEMPPIETVIKLLSAWKPGQPWPAGIPAPPPGWKPGDPLHLGAPKP
FT                   KDDGGKGSVRVEPPARVVPAAVTAPPVKPAKPVMPKVPFVKIDLHSDSDEFEEVSASDY
FT                   SSDSD"
     MATDEEVAWC AELRRAVTSL QDSIDAARSF DHVRLPADGP VSAADVVEYA RRISYTTFAP        60
     AGYQPGAPLH GIMPPAPQDE HFAASHLAAH AAQARQREEA RRAREKAAEE ARKAASRGEM       120
     PPIETVIKLL SAWKPGQPWP AGIPAPPPGW KPGDPLHLGA PKPKDDGGKG SVRVEPPARV       180
     VPAAVTAPPV KPAKPVMPKV PFVKIDLHSD SDEFEEVSAS DYSSDSD                     227
//

If you have problems or comments...

PBIL Back to PBIL home page