(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE397

MICSR_1.PE397        Location/Qualifiers
FT   CDS             769359..769808
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637027"
FT                   /orf_name="MICPUN_107918"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61791.1"
FT                   /db_xref="UniParc:UPI000199A994"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S4"
FT                   /transl_table=1
FT                   /translation="MRRKAAAGRAANADKENKESGNFALWMERGERGYTRTPGDLREVY
FT                   TAGDNAVGERGNNLYRRRHVDLLGGAASAASGIDARADRYRTTASEVSATAEEVRWEEE
FT                   NSRASEGSGLSDMASMRDAIKSASRTASERTTRSRSHLSSHVGII"
     MRRKAAAGRA ANADKENKES GNFALWMERG ERGYTRTPGD LREVYTAGDN AVGERGNNLY        60
     RRRHVDLLGG AASAASGIDA RADRYRTTAS EVSATAEEVR WEEENSRASE GSGLSDMASM       120
     RDAIKSASRT ASERTTRSRS HLSSHVGII                                         149
//

If you have problems or comments...

PBIL Back to PBIL home page