(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE398

MICSR_1.PE398        Location/Qualifiers
FT   CDS             join(770813..770918,771034..771120,771242..771497,
FT                   771609..772287)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637028"
FT                   /orf_name="MICPUN_56977"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61792.1"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="UniParc:UPI000199A995"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S5"
FT                   /transl_table=1
FT                   /translation="MPRENGVTPDGEDKESKVFRRKLRGKMRNLHKTLHESKDEIIDLT
FT                   GPVSKLGEVIEILEDIHEDVVKPREQLLDAEVMATAADLGVEMAKKMGGLGAITPAQFM
FT                   ARLCKQFVVGVDPDAQAERDEGAFNWTLFGSSVGKHFHDAPTMAFMNGAMDTQIKERRV
FT                   AQRIRRDPVGPAVAPDSVADTKADQQTDQAMKRMVKILRNKKHQNETLTVEQLSANPKS
FT                   FSQFIENIFTLSFLVKDGEAGLTPPPEGLDGPNVEKCPQVRKMKKPEEQHMDRSTFVLH
FT                   LDMEGWRRLCEANDRMEGAIPHREEVTEMDLTEGNGIGGPGAAARAEDGEEVESPGGAE
FT                   NPKGKAKPRGRGLTRPRDSTNSEERAAALRRKVAV"
     MPRENGVTPD GEDKESKVFR RKLRGKMRNL HKTLHESKDE IIDLTGPVSK LGEVIEILED        60
     IHEDVVKPRE QLLDAEVMAT AADLGVEMAK KMGGLGAITP AQFMARLCKQ FVVGVDPDAQ       120
     AERDEGAFNW TLFGSSVGKH FHDAPTMAFM NGAMDTQIKE RRVAQRIRRD PVGPAVAPDS       180
     VADTKADQQT DQAMKRMVKI LRNKKHQNET LTVEQLSANP KSFSQFIENI FTLSFLVKDG       240
     EAGLTPPPEG LDGPNVEKCP QVRKMKKPEE QHMDRSTFVL HLDMEGWRRL CEANDRMEGA       300
     IPHREEVTEM DLTEGNGIGG PGAAARAEDG EEVESPGGAE NPKGKAKPRG RGLTRPRDST       360
     NSEERAAALR RKVAV                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page