(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE399

MICSR_1.PE399        Location/Qualifiers
FT   CDS             complement(<773246..774585)
FT                   /codon_start=1
FT                   /gene_family="HOG000189846" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637029"
FT                   /orf_name="MICPUN_79984"
FT                   /product="Glycosyltransferase family 22 protein "
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /biological_process="GPI anchor biosynthetic process "
FT                   /cellular_component="intrinsic to endoplasmic reticulum
FT                   membrane"
FT                   /protein_id="ACO62219.1"
FT                   /db_xref="GO:0006506"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="GO:0031227"
FT                   /db_xref="HOGENOM:HBG397465"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="UniParc:UPI000199A996"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S6"
FT                   /transl_table=1
FT                   /translation="MKAETTDLRTVFAACVLFRVVNALCVRTFFSADEYWQSVEVAHKL
FT                   VFGYGHLTWEWTHGLRGYLHPLIFAIPYKIAQTIGLDSTAVTVWSPRIVQAVIAAAGDV
FT                   HVYKLAHRWFAGAKRKAKDEKSEGAASPDAAARWALFCSLACWFNFFCAVRTFSNCTEA
FT                   ALTVAALAYWPWTGAASENDDVKNVNRPLSLALAAASCVVRPAAALYWLPMFVEESVKS
FT                   VSRVRFILKEALPIGAAALAISTCVDRVFYGRWEIVPWNFFRFNALDGGGALYGSHPWH
FT                   WNLTQGYPAIATVFLPLAAIACRDKKRWAPLAVVGWTVLGYSVPAHKEFRFLLPALAPT
FT                   LAAAGAQLASFSCRKRVAAVALILLTQIPAALYLSLRHQSGTVSVMSVLTAAVDAGETH
FT                   SAGILSLTPCHQHPWTTHVHRPNVGMRFLRCDPPGFGTPKGELDEAD"
     MKAETTDLRT VFAACVLFRV VNALCVRTFF SADEYWQSVE VAHKLVFGYG HLTWEWTHGL        60
     RGYLHPLIFA IPYKIAQTIG LDSTAVTVWS PRIVQAVIAA AGDVHVYKLA HRWFAGAKRK       120
     AKDEKSEGAA SPDAAARWAL FCSLACWFNF FCAVRTFSNC TEAALTVAAL AYWPWTGAAS       180
     ENDDVKNVNR PLSLALAAAS CVVRPAAALY WLPMFVEESV KSVSRVRFIL KEALPIGAAA       240
     LAISTCVDRV FYGRWEIVPW NFFRFNALDG GGALYGSHPW HWNLTQGYPA IATVFLPLAA       300
     IACRDKKRWA PLAVVGWTVL GYSVPAHKEF RFLLPALAPT LAAAGAQLAS FSCRKRVAAV       360
     ALILLTQIPA ALYLSLRHQS GTVSVMSVLT AAVDAGETHS AGILSLTPCH QHPWTTHVHR       420
     PNVGMRFLRC DPPGFGTPKG ELDEAD                                            446
//

If you have problems or comments...

PBIL Back to PBIL home page