(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE4

MICSR_1.PE4          Location/Qualifiers
FT   CDS             complement(13366..14031)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636009"
FT                   /orf_name="MICPUN_56575"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62031.1"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199AA4B"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N1"
FT                   /transl_table=1
FT                   /translation="MQFSEALFPQIFPPVEEGEDPTVMTGDFATDTQPRPGRNAFGQKP
FT                   RWPREAPGGIDRATDGPAAHVLFEPSRLHEATCKGFIEEVTWLLDSAPDEQRCTVDDLD
FT                   PGGRSPLHFAAGYGHLDIVKLLTERKCKLEVRDMWMKAPVDWAIQTEQHEIIELLRIEA
FT                   VKQKIIGGKGEVAPLKTKCEFATGKTFEEIDEFMCNWENKVWDKHERACMEERENRAP"
     MQFSEALFPQ IFPPVEEGED PTVMTGDFAT DTQPRPGRNA FGQKPRWPRE APGGIDRATD        60
     GPAAHVLFEP SRLHEATCKG FIEEVTWLLD SAPDEQRCTV DDLDPGGRSP LHFAAGYGHL       120
     DIVKLLTERK CKLEVRDMWM KAPVDWAIQT EQHEIIELLR IEAVKQKIIG GKGEVAPLKT       180
     KCEFATGKTF EEIDEFMCNW ENKVWDKHER ACMEERENRA P                           221
//

If you have problems or comments...

PBIL Back to PBIL home page