(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE40

MICSR_1.PE40         Location/Qualifiers
FT   CDS             complement(80012..80356)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22636045"
FT                   /orf_name="MICPUN_56613"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62049.1"
FT                   /db_xref="UniParc:UPI000199AB2F"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R7"
FT                   /transl_table=1
FT                   /translation="MSATPPMSHPTRPGLDDLPDPPAAPRKKKPTRSRVFPAPADDDDA
FT                   ATTPAASRRRLVFGDGGEFDSPEGGGGAGAAGGAGGTRTPASPPMTRGRASGGKEPKTP
FT                   PVSKIKSMPR"
     MSATPPMSHP TRPGLDDLPD PPAAPRKKKP TRSRVFPAPA DDDDAATTPA ASRRRLVFGD        60
     GGEFDSPEGG GGAGAAGGAG GTRTPASPPM TRGRASGGKE PKTPPVSKIK SMPR             114
//

If you have problems or comments...

PBIL Back to PBIL home page