(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE400

MICSR_1.PE400        Location/Qualifiers
FT   CDS             join(complement(775655..775798),complement(775130..775618))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637030"
FT                   /gene_name="PDI"
FT                   /orf_name="MICPUN_112673"
FT                   /product="Protein disulfide isomerase "
FT                   /function="isomerase activity"
FT                   /biological_process="cell redox homeostasis"
FT                   /protein_id="ACO62220.1"
FT                   /db_xref="GO:0016853"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="HOGENOM:HBG557454"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="UniParc:UPI000199A997"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S7"
FT                   /transl_table=1
FT                   /translation="MVSSRVSGALRALIFAALIALASAAKGVVQAGDSNFDRLVLGSGK
FT                   NAFSMKPDWDKLGGHYADHPSVLIVDVDCTADGQGTCQRMGVQGYPTIKYFMSGDKKGK
FT                   DYQQGRDFNSLKSFAESKLNKPVCDAATKKGCAKNEIAFIEKHEGKSADALKEVAKEKA
FT                   DELKEIRKARSEAESELKQKQREWKKRENALNRATNILKQMQKTASA"
     MVSSRVSGAL RALIFAALIA LASAAKGVVQ AGDSNFDRLV LGSGKNAFSM KPDWDKLGGH        60
     YADHPSVLIV DVDCTADGQG TCQRMGVQGY PTIKYFMSGD KKGKDYQQGR DFNSLKSFAE       120
     SKLNKPVCDA ATKKGCAKNE IAFIEKHEGK SADALKEVAK EKADELKEIR KARSEAESEL       180
     KQKQREWKKR ENALNRATNI LKQMQKTASA                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page