(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE401

MICSR_1.PE401        Location/Qualifiers
FT   CDS             complement(776150..777319)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637031"
FT                   /orf_name="MICPUN_56980"
FT                   /product="Glycosyltransferase family 4 protein "
FT                   /function="transferase activity"
FT                   /biological_process="biosynthetic process"
FT                   /protein_id="ACO62221.1"
FT                   /db_xref="GO:0009058"
FT                   /db_xref="GO:0016740"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniParc:UPI000199A998"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S8"
FT                   /transl_table=1
FT                   /translation="MILASPDDLPPTAANPDEVGDLEQYLDAADVAVVGVLHAFKCGDV
FT                   LDQLADIKRRRGADFVPTVLVLGGTDVNVDAGDKADVLTRRAHAVDKVVSFSASMIAAA
FT                   PPGSLPSDGRTAVVPQGVSLPEEAKGVPSVEEVPSGGFEEEGFEEEGFDVADDAPSPPP
FT                   PLPLHEACGVPTSTPVFLLPAGLRPVKDVLWAVDAVDAVGAGSANASPPFVLAIVGPSL
FT                   DDKYRDAVVERLGRSKNVVLIPPVDRAHTVGYMRAATAVVNTSKSEGQSGALLEAAAAG
FT                   VPIIARDIPGNRALLDLLLDATGETPDGERDEEGFESHPCGLLCPTPESFAAALVGSAA
FT                   VRRRRSTDRAALGAGCLARNERDRWRGIIRELIGDTPEDGCGSDMAAAA"
     MILASPDDLP PTAANPDEVG DLEQYLDAAD VAVVGVLHAF KCGDVLDQLA DIKRRRGADF        60
     VPTVLVLGGT DVNVDAGDKA DVLTRRAHAV DKVVSFSASM IAAAPPGSLP SDGRTAVVPQ       120
     GVSLPEEAKG VPSVEEVPSG GFEEEGFEEE GFDVADDAPS PPPPLPLHEA CGVPTSTPVF       180
     LLPAGLRPVK DVLWAVDAVD AVGAGSANAS PPFVLAIVGP SLDDKYRDAV VERLGRSKNV       240
     VLIPPVDRAH TVGYMRAATA VVNTSKSEGQ SGALLEAAAA GVPIIARDIP GNRALLDLLL       300
     DATGETPDGE RDEEGFESHP CGLLCPTPES FAAALVGSAA VRRRRSTDRA ALGAGCLARN       360
     ERDRWRGIIR ELIGDTPEDG CGSDMAAAA                                         389
//

If you have problems or comments...

PBIL Back to PBIL home page