(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE402

MICSR_1.PE402        Location/Qualifiers
FT   CDS             complement(777446..779152)
FT                   /codon_start=1
FT                   /gene_family="HOG000253478" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637032"
FT                   /orf_name="MICPUN_56981"
FT                   /product="Predicted protein"
FT                   /function="binding"
FT                   /protein_id="ACO62222.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="HOGENOM:HBG482141"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="UniParc:UPI000199A9F5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S9"
FT                   /transl_table=1
FT                   /translation="MEARDRWFHGIHAHSVPVPGASPLNKSGSAPGSSSDSRILALATP
FT                   DDLVKLDLYGTLAEKHVGLTRRQVRLMYRDVRERTERVFAGLTPEQLRGKIESSLNPMD
FT                   WGLGHIAHFYEFMILRLLAPGSEPVLPGHDVHALFDSFRAAHDDRWKPKEVCGSDPTLG
FT                   EIRRYIADVTDRLVNLVGPDDDTRLDPVSTYLHVYGVVHEHWHVEDFIQTRHTLGYARP
FT                   NPLPSSPDPAVANVWGDTFAPPTFANIDSIGGIAQGAHSGFVSIPAGTYSLGATKDEPW
FT                   VFDAERWAHEIEVPAFRIAKAATTNAEFAAFIAAGGYHKRELWSHEGWRWLSRNRSEQK
FT                   SRGMSDEDAAKAGLNSEAPRYWVRKGSGEGGGFSKVAGGWHEHLFDAAPAPVRPHAPVL
FT                   HVSWYEAEAYCAWVGGRLPTEAEWEVAARTEPGNYGVVKGPRRRAYPWGDSPGPDPSRA
FT                   NLDGFRGNSVDVGSLPDGDSAWGCRQMLGNAWEWTSSAFLPYPGFQMDFPYRENSAPWF
FT                   GYRKVCKGGCWATSAPIARAGYRHSFWPEMNAVYTGFRVAVDGAPGAIGKL"
     MEARDRWFHG IHAHSVPVPG ASPLNKSGSA PGSSSDSRIL ALATPDDLVK LDLYGTLAEK        60
     HVGLTRRQVR LMYRDVRERT ERVFAGLTPE QLRGKIESSL NPMDWGLGHI AHFYEFMILR       120
     LLAPGSEPVL PGHDVHALFD SFRAAHDDRW KPKEVCGSDP TLGEIRRYIA DVTDRLVNLV       180
     GPDDDTRLDP VSTYLHVYGV VHEHWHVEDF IQTRHTLGYA RPNPLPSSPD PAVANVWGDT       240
     FAPPTFANID SIGGIAQGAH SGFVSIPAGT YSLGATKDEP WVFDAERWAH EIEVPAFRIA       300
     KAATTNAEFA AFIAAGGYHK RELWSHEGWR WLSRNRSEQK SRGMSDEDAA KAGLNSEAPR       360
     YWVRKGSGEG GGFSKVAGGW HEHLFDAAPA PVRPHAPVLH VSWYEAEAYC AWVGGRLPTE       420
     AEWEVAARTE PGNYGVVKGP RRRAYPWGDS PGPDPSRANL DGFRGNSVDV GSLPDGDSAW       480
     GCRQMLGNAW EWTSSAFLPY PGFQMDFPYR ENSAPWFGYR KVCKGGCWAT SAPIARAGYR       540
     HSFWPEMNAV YTGFRVAVDG APGAIGKL                                          568
//

If you have problems or comments...

PBIL Back to PBIL home page