(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE403

MICSR_1.PE403        Location/Qualifiers
FT   CDS             join(779353..780098,780169..780187)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637033"
FT                   /orf_name="MICPUN_56982"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61793.1"
FT                   /db_xref="UniParc:UPI000199A9F6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T0"
FT                   /transl_table=1
FT                   /translation="MPSGAEGFDTNGRPDDLLKRITYNANNYGKGAFLFADADAGPEDE
FT                   SRARRNRFPKRENLELEQKLYETMERQADEVVKARLAEAEKAAKEFNWDVYVDPDANAP
FT                   VEADARPGISRPNGDGCGAAMRAALPPAEPVEPESALAAEFGARCSAKEARGALEAAGG
FT                   DLEKARKLLESLASGRGRDGLRLERKRSKDGDKGKRSRKSKKRRRKRTKYDSDSDSDSD
FT                   SSSRSSSSSSSSSSSSSSRRRRKKSKNLHIYS"
     MPSGAEGFDT NGRPDDLLKR ITYNANNYGK GAFLFADADA GPEDESRARR NRFPKRENLE        60
     LEQKLYETME RQADEVVKAR LAEAEKAAKE FNWDVYVDPD ANAPVEADAR PGISRPNGDG       120
     CGAAMRAALP PAEPVEPESA LAAEFGARCS AKEARGALEA AGGDLEKARK LLESLASGRG       180
     RDGLRLERKR SKDGDKGKRS RKSKKRRRKR TKYDSDSDSD SDSSSRSSSS SSSSSSSSSS       240
     RRRRKKSKNL HIYS                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page