(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE404

MICSR_1.PE404        Location/Qualifiers
FT   CDS             join(complement(783539..783820),complement(780264..783407))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637034"
FT                   /orf_name="MICPUN_56983"
FT                   /product="Resistance-nodulation-cell division superfamily "
FT                   /function="hedgehog receptor activity"
FT                   /function="transporter activity"
FT                   /biological_process="cell division"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="ACO62223.1"
FT                   /db_xref="GO:0005215"
FT                   /db_xref="GO:0008158"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0051301"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniParc:UPI000199A9F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T1"
FT                   /transl_table=1
FT                   /translation="MHRVPRVTYPGRAACRPWLWFGSLQLPESWPGKSHFLAVESPKSP
FT                   VFTRGLLSAGRRRFQDMSPFDTIAKAVYRRPLTVYLLSILVPVALTLALLNFRIELDTG
FT                   ILSFRARDEPYAINYDAVLSAVQWGKGHTQYLHGPPSPPSPANASPPTPLSERLQSHAS
FT                   YWLTMVYETRPPGGNVLTEERLAYIAEVERKVRAVSGFEDFCHLGVPLASLNDTSCRRW
FT                   VPSSTRDQHPPACPGMQCVPAMSLMSFEGMIRRWFIELVEAGSGAANSTAGAEAVERRL
FT                   EAVGFDPAQASAMAEALAASGWDTAEAYAEMPLTELLALVPSGALTRDFFHIGHEPGWF
FT                   FDKWYATGESDGSSSGEGVRAVALRSGFEFALPLAGYATNHDRQWEQDRKYRKWAEEFT
FT                   RMLADGGEIDRGAEKVGLRVLHAGGGISEDEAAALVLGDLLWCTAAFALVTACLFAYSR
FT                   KLWWTVNAIVGISLSFPVAFFFFRAASASPYVSFLNMLVPFVLIGIGCDDAMLMFDAFR
FT                   AAIRDDCGDDDGILLPSEDVFAARYAPAARAMLATSLTTAVAFGSNFFSFIPPVRALGM
FT                   FAALTVCVNYLLVLTLLPAALVIGAKGFKNSFMDAMDECLGLFTRRGYTPRQVNESAPP
FT                   TPAQKATYSQLDTRDTEPSGGEVELQTVRGKTDDDDEADWTEVGVHDDGFFAPSTAEAK
FT                   DGGDASIVRVKKEMTCSCADLNASIRANTAAATTWLGDFVIRRKWAIIAAGVLCAVVSS
FT                   AVIADSLVVARTPPPLLREDQNLQRIQHLLFDVFYTENWSNVRVAFGVAGVDRSGADPN
FT                   DPTQFGDPVWDGSFARFNDDEYTQLAVLAACDAVTAANETLQLTPSSGSTECALQAFVR
FT                   DSGGVDSVDWGPGLPSALARWSRDMGRNWRENLGWAGEEGSSELKFITADYFVDLHPVS
FT                   STTEEIRRVHDAWEAVVAAARTAMASRLPPGSPVPLVIQACDVWNRMGVEESIGYTARI
FT                   SPAVSAAACSLIMLVATRSWRVTVAAVGTIAIAVLGMLAALVSLGWEFGVVEELCVTLL
FT                   VGSSIDYCIHLAMAYAEEAPSGAGRDERVKAALAHMAPTLTGAAMSTAASSAMLLACVV
FT                   EVLVKIGATIVANTAVGFALSLFLFSALMAAFGD"
     MHRVPRVTYP GRAACRPWLW FGSLQLPESW PGKSHFLAVE SPKSPVFTRG LLSAGRRRFQ        60
     DMSPFDTIAK AVYRRPLTVY LLSILVPVAL TLALLNFRIE LDTGILSFRA RDEPYAINYD       120
     AVLSAVQWGK GHTQYLHGPP SPPSPANASP PTPLSERLQS HASYWLTMVY ETRPPGGNVL       180
     TEERLAYIAE VERKVRAVSG FEDFCHLGVP LASLNDTSCR RWVPSSTRDQ HPPACPGMQC       240
     VPAMSLMSFE GMIRRWFIEL VEAGSGAANS TAGAEAVERR LEAVGFDPAQ ASAMAEALAA       300
     SGWDTAEAYA EMPLTELLAL VPSGALTRDF FHIGHEPGWF FDKWYATGES DGSSSGEGVR       360
     AVALRSGFEF ALPLAGYATN HDRQWEQDRK YRKWAEEFTR MLADGGEIDR GAEKVGLRVL       420
     HAGGGISEDE AAALVLGDLL WCTAAFALVT ACLFAYSRKL WWTVNAIVGI SLSFPVAFFF       480
     FRAASASPYV SFLNMLVPFV LIGIGCDDAM LMFDAFRAAI RDDCGDDDGI LLPSEDVFAA       540
     RYAPAARAML ATSLTTAVAF GSNFFSFIPP VRALGMFAAL TVCVNYLLVL TLLPAALVIG       600
     AKGFKNSFMD AMDECLGLFT RRGYTPRQVN ESAPPTPAQK ATYSQLDTRD TEPSGGEVEL       660
     QTVRGKTDDD DEADWTEVGV HDDGFFAPST AEAKDGGDAS IVRVKKEMTC SCADLNASIR       720
     ANTAAATTWL GDFVIRRKWA IIAAGVLCAV VSSAVIADSL VVARTPPPLL REDQNLQRIQ       780
     HLLFDVFYTE NWSNVRVAFG VAGVDRSGAD PNDPTQFGDP VWDGSFARFN DDEYTQLAVL       840
     AACDAVTAAN ETLQLTPSSG STECALQAFV RDSGGVDSVD WGPGLPSALA RWSRDMGRNW       900
     RENLGWAGEE GSSELKFITA DYFVDLHPVS STTEEIRRVH DAWEAVVAAA RTAMASRLPP       960
     GSPVPLVIQA CDVWNRMGVE ESIGYTARIS PAVSAAACSL IMLVATRSWR VTVAAVGTIA      1020
     IAVLGMLAAL VSLGWEFGVV EELCVTLLVG SSIDYCIHLA MAYAEEAPSG AGRDERVKAA      1080
     LAHMAPTLTG AAMSTAASSA MLLACVVEVL VKIGATIVAN TAVGFALSLF LFSALMAAFG      1140
     D                                                                      1141
//

If you have problems or comments...

PBIL Back to PBIL home page