(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE405

MICSR_1.PE405        Location/Qualifiers
FT   CDS             complement(784798..785670)
FT                   /codon_start=1
FT                   /gene_family="HOG000264353" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637035"
FT                   /orf_name="MICPUN_56985"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62224.1"
FT                   /db_xref="HOGENOM:HBG560191"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="UniParc:UPI000199A9F8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T2"
FT                   /transl_table=1
FT                   /translation="MSSASTLSARVAHSAGVRAPGGARRSFRATRIVSRAVAEDESSSS
FT                   AVYQPAVAPEQPSGADVNAAAKKRLLAVAAASGRGLDATPAQKTAASSLIAELIAANPN
FT                   PEPATSPTIDGDWELVYSDTFLFRSSPFFWAVGSMMGDTADFFYQAHSHQTGIFGGGVG
FT                   RVVQTVDTKGGRLISDCVVKASVGIPLLGFSPVFAGYGSVITAGRCAAKDGTRLAVTAE
FT                   TTTVRQDDANVLPQLNFLNGTTVPVEDVMKQVGGGEAGPEVYLDTFYLDDEMRISKLED
FT                   GSVFVYQRC"
     MSSASTLSAR VAHSAGVRAP GGARRSFRAT RIVSRAVAED ESSSSAVYQP AVAPEQPSGA        60
     DVNAAAKKRL LAVAAASGRG LDATPAQKTA ASSLIAELIA ANPNPEPATS PTIDGDWELV       120
     YSDTFLFRSS PFFWAVGSMM GDTADFFYQA HSHQTGIFGG GVGRVVQTVD TKGGRLISDC       180
     VVKASVGIPL LGFSPVFAGY GSVITAGRCA AKDGTRLAVT AETTTVRQDD ANVLPQLNFL       240
     NGTTVPVEDV MKQVGGGEAG PEVYLDTFYL DDEMRISKLE DGSVFVYQRC                  290
//

If you have problems or comments...

PBIL Back to PBIL home page