(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE407

MICSR_1.PE407        Location/Qualifiers
FT   CDS             <790154..>790432
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637037"
FT                   /orf_name="MICPUN_76840"
FT                   /product="Carbohydrate-binding module family 20 protein "
FT                   /function="carbohydrate binding"
FT                   /function="catalytic activity"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="ACO61795.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0030246"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniParc:UPI000199A9FA"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T4"
FT                   /transl_table=1
FT                   /translation="IRDDGSSTSNVVEFNVVAHLTVGEHLVLVGNVAELGGWKVDVGRR
FT                   MTWSEGDVWKTSISIPNAEASVEFKFVRYNDNNGVLTWQEGDNYACEL"
     IRDDGSSTSN VVEFNVVAHL TVGEHLVLVG NVAELGGWKV DVGRRMTWSE GDVWKTSISI        60
     PNAEASVEFK FVRYNDNNGV LTWQEGDNYA CEL                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page