(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE409

MICSR_1.PE409        Location/Qualifiers
FT   CDS             join(797905..797997,798118..798206,798333..799170)
FT                   /codon_start=1
FT                   /gene_family="HOG000214351" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637039"
FT                   /orf_name="MICPUN_56989"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO61796.1"
FT                   /db_xref="HOGENOM:HBG676888"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="UniParc:UPI000199A9FC"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T6"
FT                   /transl_table=1
FT                   /translation="MASRRLLRAASAGDIDAVDALIREGADPGFQDRKGTTPLMLACEH
FT                   GHVDVVRSLLAAGAPWNELDNEGHCAGEYASAGGHAELTDALIDHAVSAEMVLGAVSRA
FT                   RPREADLTYLSQPVRYDGDDKLLDTENDAVMMDWEAPLMRIHAQVMCAGKGDTLNVGFG
FT                   MGIIDGYVVNENETRSHTIIEAHPDVHAHMLRRGWDAKRGVRVEFGRWQEVLDRIIREN
FT                   ESLPDGEKRLFDGVNFDTYGEDYDDLREFHALLPKIMRPGGVYTYFNGLAPDNIFFHTV
FT                   YCRLAQAELASLGFDTKFDVVDIDTRDPEIWRGVKRRYWWGDKYFLPTCTLTGAAGSE"
     MASRRLLRAA SAGDIDAVDA LIREGADPGF QDRKGTTPLM LACEHGHVDV VRSLLAAGAP        60
     WNELDNEGHC AGEYASAGGH AELTDALIDH AVSAEMVLGA VSRARPREAD LTYLSQPVRY       120
     DGDDKLLDTE NDAVMMDWEA PLMRIHAQVM CAGKGDTLNV GFGMGIIDGY VVNENETRSH       180
     TIIEAHPDVH AHMLRRGWDA KRGVRVEFGR WQEVLDRIIR ENESLPDGEK RLFDGVNFDT       240
     YGEDYDDLRE FHALLPKIMR PGGVYTYFNG LAPDNIFFHT VYCRLAQAEL ASLGFDTKFD       300
     VVDIDTRDPE IWRGVKRRYW WGDKYFLPTC TLTGAAGSE                              339
//

If you have problems or comments...

PBIL Back to PBIL home page