(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE41

MICSR_1.PE41         Location/Qualifiers
FT   CDS             join(81190..81219,81391..81435,81611..82810)
FT                   /codon_start=1
FT                   /gene_family="HOG000260959" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22636046"
FT                   /orf_name="MICPUN_97107"
FT                   /product="Predicted protein"
FT                   /function="GTP binding"
FT                   /function="adenylosuccinate synthase activity"
FT                   /function="magnesium ion binding"
FT                   /biological_process="purine nucleotide biosynthetic process"
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="ACO61604.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0004019"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006164"
FT                   /db_xref="HOGENOM:HBG658237"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="UniParc:UPI000199AB30"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R8"
FT                   /transl_table=1
FT                   /translation="MSAVALSSAAWGDEGKGKLVDILAQEYDIVARCQGGANAGHTIYD
FT                   DEGKKYALHLVPSGILNEKAKCVVGNGVVVHLPGMFNEIDTLEKAGVKIDASRLVISDR
FT                   AHMLFDLHKEIDGLREAELSGNKIGTTKRGIGPAYASKATRNGIRVGDIRNPETFAQKL
FT                   RTLAADAAARFEDFEYDVEAELVAYQKYAERITPFIADTVHMINEEHKAGKRVLVEGAN
FT                   ATMLDLDFGTYPFVTSSNPSLGGVCSGLGLAPNKFETVIGVAKAYTTRVGAGPYPTELF
FT                   GELADDLREKGYEYGTTTGRPRRIGWLDVVALNYASAINGFTHLNLTKLDVLSGLPELK
FT                   IATAYKLGDGTVTNAFPSSIEELEKVECVYETLPGWEEDISKMRDWDELPAKCKAYVEK
FT                   IEELTGVECRYLGVGPGRDAIVVKP"
     MSAVALSSAA WGDEGKGKLV DILAQEYDIV ARCQGGANAG HTIYDDEGKK YALHLVPSGI        60
     LNEKAKCVVG NGVVVHLPGM FNEIDTLEKA GVKIDASRLV ISDRAHMLFD LHKEIDGLRE       120
     AELSGNKIGT TKRGIGPAYA SKATRNGIRV GDIRNPETFA QKLRTLAADA AARFEDFEYD       180
     VEAELVAYQK YAERITPFIA DTVHMINEEH KAGKRVLVEG ANATMLDLDF GTYPFVTSSN       240
     PSLGGVCSGL GLAPNKFETV IGVAKAYTTR VGAGPYPTEL FGELADDLRE KGYEYGTTTG       300
     RPRRIGWLDV VALNYASAIN GFTHLNLTKL DVLSGLPELK IATAYKLGDG TVTNAFPSSI       360
     EELEKVECVY ETLPGWEEDI SKMRDWDELP AKCKAYVEKI EELTGVECRY LGVGPGRDAI       420
     VVKP                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page