(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE410

MICSR_1.PE410        Location/Qualifiers
FT   CDS             join(799328..801076,801114..802796)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637040"
FT                   /orf_name="MICPUN_56990"
FT                   /product="Predicted protein"
FT                   /function="RNA methyltransferase activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="RNA processing"
FT                   /protein_id="ACO61797.1"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="GO:0008173"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011046"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR019781"
FT                   /db_xref="InterPro:IPR019782"
FT                   /db_xref="UniParc:UPI000199A9FD"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T7"
FT                   /transl_table=1
FT                   /translation="MEDPGAPDWSRCRRVAAIHAHSASVKCVSGGRWPAGHPGESGRMR
FT                   GDDSRTTVDGFATAGLDGAARVWTLDGTSSSGFRCVAAFGDHTAGVRAVAMPPPRGTGR
FT                   DRASSSSSSSSGIPRTAPEMLAATGSYDRTARLWHASRAVPPVPPLANGHSDYVLCVSF
FT                   GPDARTLVTGGADGRICVWDCDDAAAGNPAPAACLRPGSNAAVRSVDASLPPPSEDEPG
FT                   DVLSMTGGEDGTLRVFSHASGGGAVCEVVFAGHGGAVTSLALCRGEERGWGSPPRARKE
FT                   NVPGTRRIRIAAGHDGGVLSVHDAALTSEAGGDENARASVKVKVREAFVGRVHANGAAR
FT                   ATLLLRPDARIVASASEDRTVRLWNMQKGNCLSVLVGARCTVESVSFSALGDLLYAGLA
FT                   DGHVWVYLEESGEEEDDACAGGGIERRVIESRLALAMEALRDPKDPRASSASESERCAS
FT                   GAAPSARRFQDAYEEMECDALGLLPRVDRSNVALVGEVAGGSLGGGGFAWSERGNPTLS
FT                   CSVCRGELELGFEDPGGDWPAPLPCGHVFHARSCLVPWLRHSPACPLCRANALGSGEPP
FT                   PAACLPVEPKRSCWSSLRARGSREVAGYSGFVPIESSTMTGDASSTAAEGARGEPVPGG
FT                   EPAAQEEIPEYHDPVDASTYSAALDAKVAELERLFSPLMQQASIPILNAKGVDRSVSVR
FT                   PEVFPSPPLNFRSRCRFQVMWEDAPVTAESTGITPGESVEPGRRLSYRMWNKGKPTVPI
FT                   TEFPMALREIEELMPAVLREAEAHPELGDGLQAIHFLASRGIRGGMLVTMVYGRPIDEA
FT                   WKMAAEGPRARLKAAMVDIRERVYGGGDDDGFDGFAGPRGDDEELDATALNILGRSRGT
FT                   QIVVGDACHVFETLALRDGRRLRYRQAEGAFSNPNSFMAESTLDWLCDCAATTVREALG
FT                   GTSEHSAEAAPPSLLELYSGNGNHTVALAKYFDSVAAVELSGVLCEAARENLERNGVEN
FT                   AKVLHSPSESVARGMLRRKKRHEEGRVGKAAMAAAATGAGDGSKRGDGSGMEFDINAYD
FT                   VVLVDPPRAGLDPDTLDLVSRFDVVLYISCDPRKGLLENAVGPHAARALDTGEFEGEFK
FT                   GWSGLARTHDLVRFAVFDHFPYTRHIECGACFVRRR"
     MEDPGAPDWS RCRRVAAIHA HSASVKCVSG GRWPAGHPGE SGRMRGDDSR TTVDGFATAG        60
     LDGAARVWTL DGTSSSGFRC VAAFGDHTAG VRAVAMPPPR GTGRDRASSS SSSSSGIPRT       120
     APEMLAATGS YDRTARLWHA SRAVPPVPPL ANGHSDYVLC VSFGPDARTL VTGGADGRIC       180
     VWDCDDAAAG NPAPAACLRP GSNAAVRSVD ASLPPPSEDE PGDVLSMTGG EDGTLRVFSH       240
     ASGGGAVCEV VFAGHGGAVT SLALCRGEER GWGSPPRARK ENVPGTRRIR IAAGHDGGVL       300
     SVHDAALTSE AGGDENARAS VKVKVREAFV GRVHANGAAR ATLLLRPDAR IVASASEDRT       360
     VRLWNMQKGN CLSVLVGARC TVESVSFSAL GDLLYAGLAD GHVWVYLEES GEEEDDACAG       420
     GGIERRVIES RLALAMEALR DPKDPRASSA SESERCASGA APSARRFQDA YEEMECDALG       480
     LLPRVDRSNV ALVGEVAGGS LGGGGFAWSE RGNPTLSCSV CRGELELGFE DPGGDWPAPL       540
     PCGHVFHARS CLVPWLRHSP ACPLCRANAL GSGEPPPAAC LPVEPKRSCW SSLRARGSRE       600
     VAGYSGFVPI ESSTMTGDAS STAAEGARGE PVPGGEPAAQ EEIPEYHDPV DASTYSAALD       660
     AKVAELERLF SPLMQQASIP ILNAKGVDRS VSVRPEVFPS PPLNFRSRCR FQVMWEDAPV       720
     TAESTGITPG ESVEPGRRLS YRMWNKGKPT VPITEFPMAL REIEELMPAV LREAEAHPEL       780
     GDGLQAIHFL ASRGIRGGML VTMVYGRPID EAWKMAAEGP RARLKAAMVD IRERVYGGGD       840
     DDGFDGFAGP RGDDEELDAT ALNILGRSRG TQIVVGDACH VFETLALRDG RRLRYRQAEG       900
     AFSNPNSFMA ESTLDWLCDC AATTVREALG GTSEHSAEAA PPSLLELYSG NGNHTVALAK       960
     YFDSVAAVEL SGVLCEAARE NLERNGVENA KVLHSPSESV ARGMLRRKKR HEEGRVGKAA      1020
     MAAAATGAGD GSKRGDGSGM EFDINAYDVV LVDPPRAGLD PDTLDLVSRF DVVLYISCDP      1080
     RKGLLENAVG PHAARALDTG EFEGEFKGWS GLARTHDLVR FAVFDHFPYT RHIECGACFV      1140
     RRR                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page