(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE411

MICSR_1.PE411        Location/Qualifiers
FT   CDS             complement(802878..804866)
FT                   /codon_start=1
FT                   /gene_family="HOG000240610" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637041"
FT                   /orf_name="MICPUN_99494"
FT                   /product="Predicted protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="nucleic acid binding"
FT                   /function="tRNA dihydrouridine synthase activity "
FT                   /function="zinc ion binding"
FT                   /biological_process="oxidation-reduction process "
FT                   /biological_process="tRNA processing"
FT                   /protein_id="ACO62226.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008033"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="GO:0017150"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="HOGENOM:HBG521382"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="UniParc:UPI000199A9FE"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T8"
FT                   /transl_table=1
FT                   /translation="MSEFTGPDGKPWVPPTADDLIAKGSAAVKTEYLRPVPPLADTNAN
FT                   VVDDDKAEAGKRGDGGVDKKRTGKSRRALAREKKQARESGADLCSAFSKGACTFGDKCR
FT                   YSHNVESYLRAKQPDLPGACPFIAAGKDKCPHGIMCRYLGTHPPVPDTEENKLLPALTP
FT                   QTTAELKERNAAPGVNEGVLELPVPESPGGPFGPDDEMNQFCGWLKVRLRKGQVRFDKA
FT                   DAVLKELGVESSWRYGKEGDEKLRKKYGEKKDVVDPGEGGGDETREDDDEGGGKRSKVD
FT                   PDNTAEGVDVKLRPVEKKTIDFRGKLYLAPLTTTGNLPFRRICKRYGVDITCGEMAMVT
FT                   NLLQGQPAEWALLRRHPSEDIFGAQVCGGYSDSMSRCMQLLEDEVVSKGGLDFIDINMG
FT                   CPIDLVCNKGAGSMLLEKPARMEQLVRASAPLLSCPLTLKTRMGYFDNKRVAHEIIPKM
FT                   VDWGLAGMTLHGRSRQQRYSRLADWDYINQCARASPIQLIGNGDVFSYHDYVKNVEGQG
FT                   VATCMIARGALIKPWIFTEIKERRDWDISATERLDMLKDYAAFGLEHWGADARGVANTR
FT                   RFLLEWLSFLHRYVPVGLLERMPVGIHQRPPNYVGRSDLETLLSSPNSEDWVKITTMLL
FT                   GPTPDNFSFQPKHKSNAYSKESDQVQG"
     MSEFTGPDGK PWVPPTADDL IAKGSAAVKT EYLRPVPPLA DTNANVVDDD KAEAGKRGDG        60
     GVDKKRTGKS RRALAREKKQ ARESGADLCS AFSKGACTFG DKCRYSHNVE SYLRAKQPDL       120
     PGACPFIAAG KDKCPHGIMC RYLGTHPPVP DTEENKLLPA LTPQTTAELK ERNAAPGVNE       180
     GVLELPVPES PGGPFGPDDE MNQFCGWLKV RLRKGQVRFD KADAVLKELG VESSWRYGKE       240
     GDEKLRKKYG EKKDVVDPGE GGGDETREDD DEGGGKRSKV DPDNTAEGVD VKLRPVEKKT       300
     IDFRGKLYLA PLTTTGNLPF RRICKRYGVD ITCGEMAMVT NLLQGQPAEW ALLRRHPSED       360
     IFGAQVCGGY SDSMSRCMQL LEDEVVSKGG LDFIDINMGC PIDLVCNKGA GSMLLEKPAR       420
     MEQLVRASAP LLSCPLTLKT RMGYFDNKRV AHEIIPKMVD WGLAGMTLHG RSRQQRYSRL       480
     ADWDYINQCA RASPIQLIGN GDVFSYHDYV KNVEGQGVAT CMIARGALIK PWIFTEIKER       540
     RDWDISATER LDMLKDYAAF GLEHWGADAR GVANTRRFLL EWLSFLHRYV PVGLLERMPV       600
     GIHQRPPNYV GRSDLETLLS SPNSEDWVKI TTMLLGPTPD NFSFQPKHKS NAYSKESDQV       660
     QG                                                                      662
//

If you have problems or comments...

PBIL Back to PBIL home page