(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE412

MICSR_1.PE412        Location/Qualifiers
FT   CDS             join(complement(807920..>808056),
FT                   complement(<807347..807859))
FT                   /codon_start=1
FT                   /gene_family="HOG000252209" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637042"
FT                   /orf_name="MICPUN_71484"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="catalytic activity"
FT                   /biological_process="base-excision repair"
FT                   /protein_id="ACO62227.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0006284"
FT                   /db_xref="HOGENOM:HBG464473"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniParc:UPI000199A9FF"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T9"
FT                   /transl_table=1
FT                   /translation="SPFPNLARPTVDECWAARDALAKLHSSFFQQFETQQAAGGDAIGP
FT                   GKTVLDSLVGTILSQNTTDTNSHRAFAILKHRFPTWEQVRTAKPAKVEDAIRCGGLAEV
FT                   KVSRIQVILNTLKEERGECSMEYLRDMSDDDVKAELSRFKGVGPKTVSCVLMFCLKRPD
FT                   FPVDTHVWKIAKDLGWIPKGAGREDAYEHLNRRVPDDCKFDLHVLLVEHGKVY"
     SPFPNLARPT VDECWAARDA LAKLHSSFFQ QFETQQAAGG DAIGPGKTVL DSLVGTILSQ        60
     NTTDTNSHRA FAILKHRFPT WEQVRTAKPA KVEDAIRCGG LAEVKVSRIQ VILNTLKEER       120
     GECSMEYLRD MSDDDVKAEL SRFKGVGPKT VSCVLMFCLK RPDFPVDTHV WKIAKDLGWI       180
     PKGAGREDAY EHLNRRVPDD CKFDLHVLLV EHGKVY                                 216
//

If you have problems or comments...

PBIL Back to PBIL home page