(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE413

MICSR_1.PE413        Location/Qualifiers
FT   CDS             join(808814..808970,809076..812455)
FT                   /codon_start=1
FT                   /gene_family="HOG000222962" [ FAMILY / ALN / TREE ]
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI22637043"
FT                   /orf_name="MICPUN_93697"
FT                   /product="Predicted protein"
FT                   /function="DNA binding"
FT                   /function="DNA-directed RNA polymerase activity "
FT                   /function="ribonucleoside binding"
FT                   /protein_id="ACO61798.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003899"
FT                   /db_xref="GO:0032549"
FT                   /db_xref="HOGENOM:HBG317648"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="UniParc:UPI000199AA62"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U0"
FT                   /transl_table=1
FT                   /translation="MSEENVAVEEEEEIGQEDAWTVISSFFEEKGLARQQLDSFNEFIQ
FT                   HTMQEIVDEMSDFTIEPEEQHMPGEEADGKGKKKYKVEFKQIYLSKPMVTEADGMTSTL
FT                   FPKEARLRNLTYSAPLYIDMAKSTITTTDEIDATTGKYIETIDTEEYPKVFFGKVPIML
FT                   RSQYCSLHDHTDKELTELGECPYDEGGYFIINGSEKVLIAQEKMSTNHVYVFEKRQPSK
FT                   YMWVAECRSSPESGARAASSCMARLCHAPGTKDEAGVISVTIPYIRTEIPLFVVFRALG
FT                   FVADKDILEHLVYDFEDHEMMQLLRNSIEEAQVIQSQDVALDFIGKRGSAVGVTRPKRI
FT                   QYAREILQKELLPHVGVNEGCETKKAYFLGYIVNRLLLCALGRKKEDDRDHFGNKRMDL
FT                   SGPLIAMLFRQLFRKVTKDVRLYSQRCIDSGKDIQLTLAVKAKTITSGLKYSLATGNWG
FT                   AQGAQDIRAGVSQVLNRLSFSSTLSHLRRLNSPIGREGKLAKPRQLHNSHWGMVCPAET
FT                   PEGQAVGLVKNLSLMCLVSVGSPSAPLLEFLEEWSMENLEEISPSVIVNATKIFVNGVW
FT                   VGVHREPAQLVQTLRNLRRKLDITIEVGVVHDIALRELRLYTDYGRCIRPLFIVEDNHL
FT                   VIKKKDIQMLYEKEITGYTWNDLVATGCIEYVDTEEEETTMIAMTIDELVGQRINAEPG
FT                   GVKHMYTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGMYVTNFQIRMDT
FT                   LAYVLFYPQKPLVTTRAMEHLHFRELPAGVNVVVGIMCYTGYNQEDSVIMNQSSIDRGL
FT                   FRSIFYRSFKDEEKKQGSLTKEELERPSRDTTLGMRHGTYDKLDDDGLICPGTRVSGED
FT                   IIIGKTSPLPEDDPSAVSKRFTKRDCSTGMKNSETGIIDQVLLTTNDQGLRFVKIRVRS
FT                   CRTPQVGDKFSSRHGQKGTIGMTYTQEDMPFTCEGIVPDIIVNPHAIPSRMTIGQLVEC
FT                   LMGKVAAMMGKEGDATPFTPVTVESISDMLHMCGYQKRGNEVMYNGHTGRKLEAKIFLG
FT                   PTYYQRLKHMVDDKIHSRGRGPVQILTRQPMEGRSRDGGLRFGEMERDCIISHGAAAFL
FT                   KERLMDQSDAYRIHVCETCGLIAVANLKNQTFECCKNPSERTKVVQVMMPYACKLLFQE
FT                   LMSMAVAPRLVT"
     MSEENVAVEE EEEIGQEDAW TVISSFFEEK GLARQQLDSF NEFIQHTMQE IVDEMSDFTI        60
     EPEEQHMPGE EADGKGKKKY KVEFKQIYLS KPMVTEADGM TSTLFPKEAR LRNLTYSAPL       120
     YIDMAKSTIT TTDEIDATTG KYIETIDTEE YPKVFFGKVP IMLRSQYCSL HDHTDKELTE       180
     LGECPYDEGG YFIINGSEKV LIAQEKMSTN HVYVFEKRQP SKYMWVAECR SSPESGARAA       240
     SSCMARLCHA PGTKDEAGVI SVTIPYIRTE IPLFVVFRAL GFVADKDILE HLVYDFEDHE       300
     MMQLLRNSIE EAQVIQSQDV ALDFIGKRGS AVGVTRPKRI QYAREILQKE LLPHVGVNEG       360
     CETKKAYFLG YIVNRLLLCA LGRKKEDDRD HFGNKRMDLS GPLIAMLFRQ LFRKVTKDVR       420
     LYSQRCIDSG KDIQLTLAVK AKTITSGLKY SLATGNWGAQ GAQDIRAGVS QVLNRLSFSS       480
     TLSHLRRLNS PIGREGKLAK PRQLHNSHWG MVCPAETPEG QAVGLVKNLS LMCLVSVGSP       540
     SAPLLEFLEE WSMENLEEIS PSVIVNATKI FVNGVWVGVH REPAQLVQTL RNLRRKLDIT       600
     IEVGVVHDIA LRELRLYTDY GRCIRPLFIV EDNHLVIKKK DIQMLYEKEI TGYTWNDLVA       660
     TGCIEYVDTE EEETTMIAMT IDELVGQRIN AEPGGVKHMY THCEIHPSMI LGICASIIPF       720
     PDHNQSPRNT YQSAMGKQAM GMYVTNFQIR MDTLAYVLFY PQKPLVTTRA MEHLHFRELP       780
     AGVNVVVGIM CYTGYNQEDS VIMNQSSIDR GLFRSIFYRS FKDEEKKQGS LTKEELERPS       840
     RDTTLGMRHG TYDKLDDDGL ICPGTRVSGE DIIIGKTSPL PEDDPSAVSK RFTKRDCSTG       900
     MKNSETGIID QVLLTTNDQG LRFVKIRVRS CRTPQVGDKF SSRHGQKGTI GMTYTQEDMP       960
     FTCEGIVPDI IVNPHAIPSR MTIGQLVECL MGKVAAMMGK EGDATPFTPV TVESISDMLH      1020
     MCGYQKRGNE VMYNGHTGRK LEAKIFLGPT YYQRLKHMVD DKIHSRGRGP VQILTRQPME      1080
     GRSRDGGLRF GEMERDCIIS HGAAAFLKER LMDQSDAYRI HVCETCGLIA VANLKNQTFE      1140
     CCKNPSERTK VVQVMMPYAC KLLFQELMSM AVAPRLVT                              1178
//

If you have problems or comments...

PBIL Back to PBIL home page