(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE414

MICSR_1.PE414        Location/Qualifiers
FT   CDS             join(<812765..813451,813545..>814126)
FT                   /codon_start=1
FT                   /gene_family="HOG000015126" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637044"
FT                   /orf_name="MICPUN_67496"
FT                   /product="Predicted protein"
FT                   /function="hydrolase activity"
FT                   /protein_id="ACO61799.1"
FT                   /db_xref="GO:0016787"
FT                   /db_xref="HOGENOM:HBG143928"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="UniParc:UPI000199AA63"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U1"
FT                   /transl_table=1
FT                   /translation="ILLIWAPAIFYRERVAFNLAGASCQWPAVDEGNGARSSDPSVHVA
FT                   VVADPQLTTYLSYRELGRGNPGLIAVEGISDAYMSRAFRRAVLSNDPEHVLFLGDLIDQ
FT                   GEWIVNPEEWDQARGRFDRIFRWPRRAWSGDVHATGPLDDGDDGVPRDRERPVSYRTVH
FT                   GNHDVGYSRHAVRLRHLHARHEEYFGSTNFVRRLGGVDLVGVGAMALDGADDPGARSAQ
FT                   TNETWAFARRCVGEPARPRVLVTHVPLSKRSYEPGTCGDQRTSEVIRDKTHMSSTAGGR
FT                   RIEIPRHDGLGCYYQDYLRPATSRRLLDKVRPTLVLSGHDHDQCVGTHEVFASDATGRA
FT                   CATSGRSATEHTVGSFSFLMGNPRPSFAMMTVRGACGMDDGACPAELGTGGARDAVNVS
FT                   LCFLPSQWSTFKVYGALGVITVFA"
     ILLIWAPAIF YRERVAFNLA GASCQWPAVD EGNGARSSDP SVHVAVVADP QLTTYLSYRE        60
     LGRGNPGLIA VEGISDAYMS RAFRRAVLSN DPEHVLFLGD LIDQGEWIVN PEEWDQARGR       120
     FDRIFRWPRR AWSGDVHATG PLDDGDDGVP RDRERPVSYR TVHGNHDVGY SRHAVRLRHL       180
     HARHEEYFGS TNFVRRLGGV DLVGVGAMAL DGADDPGARS AQTNETWAFA RRCVGEPARP       240
     RVLVTHVPLS KRSYEPGTCG DQRTSEVIRD KTHMSSTAGG RRIEIPRHDG LGCYYQDYLR       300
     PATSRRLLDK VRPTLVLSGH DHDQCVGTHE VFASDATGRA CATSGRSATE HTVGSFSFLM       360
     GNPRPSFAMM TVRGACGMDD GACPAELGTG GARDAVNVSL CFLPSQWSTF KVYGALGVIT       420
     VFA                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page