(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE415

MICSR_1.PE415        Location/Qualifiers
FT   CDS             complement(814356..815450)
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637045"
FT                   /orf_name="MICPUN_56996"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62228.1"
FT                   /db_xref="UniParc:UPI000199AA64"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U2"
FT                   /transl_table=1
FT                   /translation="MFKREEPETERLLASNPRQKLTVHRGQLYFNDPRVAGAAAPASSS
FT                   GQSHSARIAEKYGGRRYFGGGFSDNTLVDLNQSSSEGDVTSGTEYSDYDYVTDERAQQM
FT                   ERGMRGASVPAGIQTRTAVSNRRGRSGSSSYSNMINASTAMIALVVCAVLVALGLFATG
FT                   AVSTDVVSSMFSVERESLAPQADVSESDDHAHGHRASTRSARDEKEEEEDKVYPVEIGA
FT                   DADAIGPRAAARAAEEAARKRAAASAKLGDDAKKGARRASSKGASSKRAFSRKASSLGD
FT                   AARMRPKGVSGEDASSFATRSTSKGPESAGTAKAADAGAKLGDFQKAEEAAARMRNMGF
FT                   ASPEVPNREEPAAETEEASDESRR"
     MFKREEPETE RLLASNPRQK LTVHRGQLYF NDPRVAGAAA PASSSGQSHS ARIAEKYGGR        60
     RYFGGGFSDN TLVDLNQSSS EGDVTSGTEY SDYDYVTDER AQQMERGMRG ASVPAGIQTR       120
     TAVSNRRGRS GSSSYSNMIN ASTAMIALVV CAVLVALGLF ATGAVSTDVV SSMFSVERES       180
     LAPQADVSES DDHAHGHRAS TRSARDEKEE EEDKVYPVEI GADADAIGPR AAARAAEEAA       240
     RKRAAASAKL GDDAKKGARR ASSKGASSKR AFSRKASSLG DAARMRPKGV SGEDASSFAT       300
     RSTSKGPESA GTAKAADAGA KLGDFQKAEE AAARMRNMGF ASPEVPNREE PAAETEEASD       360
     ESRR                                                                    364
//

If you have problems or comments...

PBIL Back to PBIL home page