(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE416

MICSR_1.PE416        Location/Qualifiers
FT   CDS             join(<816125..816938,816978..>817258)
FT                   /codon_start=1
FT                   /gene_family="HOG000197965" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637046"
FT                   /orf_name="MICPUN_67316"
FT                   /product="Predicted protein"
FT                   /function="ATP binding"
FT                   /protein_id="ACO61800.1"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="HOGENOM:HBG664131"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="UniParc:UPI000199AA65"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U3"
FT                   /transl_table=1
FT                   /translation="SPLGAYERLSKQGVLRWDEAQHRALKTLNELHAKLVGDMDGGAAA
FT                   AKRKSEAPKKEGSWFTDLFTAREEDDEGGYASHGGVYLFGGPGCGKTFCMDLFYASLPG
FT                   TDGKEKRREHFHSFMLHTHQTLHKLGKAGHTEDTVAIYAQRVAKKTRVLCLDEFQVTDV
FT                   ADAMIIRRLLDQLWERGVTIVTTSNREPDELYKNGLNRVQFLPCIEAIKARCVVHPMES
FT                   VRDYRLTGRGIAGEDTTGGESGGFKGTWRVRREGESHEEGERWLERRLQPMGGRRIQVP
FT                   RAGGGVALFRFDEVCASAMGAGDYTAVASTFHTVGLSRVPRMTIERVDLMRRFITFIDV
FT                   MYEHKVKLLACAPTSPATLFESSGG"
     SPLGAYERLS KQGVLRWDEA QHRALKTLNE LHAKLVGDMD GGAAAAKRKS EAPKKEGSWF        60
     TDLFTAREED DEGGYASHGG VYLFGGPGCG KTFCMDLFYA SLPGTDGKEK RREHFHSFML       120
     HTHQTLHKLG KAGHTEDTVA IYAQRVAKKT RVLCLDEFQV TDVADAMIIR RLLDQLWERG       180
     VTIVTTSNRE PDELYKNGLN RVQFLPCIEA IKARCVVHPM ESVRDYRLTG RGIAGEDTTG       240
     GESGGFKGTW RVRREGESHE EGERWLERRL QPMGGRRIQV PRAGGGVALF RFDEVCASAM       300
     GAGDYTAVAS TFHTVGLSRV PRMTIERVDL MRRFITFIDV MYEHKVKLLA CAPTSPATLF       360
     ESSGG                                                                   365
//

If you have problems or comments...

PBIL Back to PBIL home page