(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE417

MICSR_1.PE417        Location/Qualifiers
FT   CDS             complement(817779..818204)
FT                   /codon_start=1
FT                   /gene_family="HOG000004132" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637047"
FT                   /orf_name="MICPUN_56998"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62229.1"
FT                   /db_xref="HOGENOM:HBG731751"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="UniParc:UPI000199AA66"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U4"
FT                   /transl_table=1
FT                   /translation="MARSPHYSHTLVIRYSECDQQGVVFNAHYQAMCDCVMDLWLRDRM
FT                   GLAWVNDVVTNGGGFSMVVASEFKYISPAKFLDDLTISGEVLRWGTTSFEVGYVGEVHS
FT                   RRCFEGKLTYVAVDPDAKPTPVPAEFRERMTAKRSRL"
     MARSPHYSHT LVIRYSECDQ QGVVFNAHYQ AMCDCVMDLW LRDRMGLAWV NDVVTNGGGF        60
     SMVVASEFKY ISPAKFLDDL TISGEVLRWG TTSFEVGYVG EVHSRRCFEG KLTYVAVDPD       120
     AKPTPVPAEF RERMTAKRSR L                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page