(data stored in ACNUC8465 zone)

HOGENOMDNA: MICSR_1.PE419

MICSR_1.PE419        Location/Qualifiers
FT   CDS             join(complement(821244..821547),complement(820601..821142))
FT                   /codon_start=1
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /evidence="4: Predicted"
FT                   /gene_id="IGI22637337"
FT                   /orf_name="MICPUN_57000"
FT                   /product="Predicted protein"
FT                   /protein_id="ACO62230.1"
FT                   /db_xref="UniParc:UPI000199AA68"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U6"
FT                   /transl_table=1
FT                   /translation="MPKPRSRPSSDAQRRPPIRRDSTRVVNRLTTFPTHACWSEILKRS
FT                   DGKDRVVGLIQYVAMVISGGRPGSVLTSIGFALNDARRPFRLYTPVAVLIDTFLAKGKP
FT                   KTKGAMRTLECIKAISTAVYVTCDHVVWAGGAGAVDKRSTLYKVCDKLSLMGWAAGSAL
FT                   MAAGHVPDLIAYTRALRDPLASDNKRDDDVDEWELREELEEKTVASALDVASGLTQALF
FT                   ALSLLGATPLKGRQMQCVGLAMGIVGVMRQLVSVPLPPEKTGMGRMGRLPISPSMPMLR
FT                   "
     MPKPRSRPSS DAQRRPPIRR DSTRVVNRLT TFPTHACWSE ILKRSDGKDR VVGLIQYVAM        60
     VISGGRPGSV LTSIGFALND ARRPFRLYTP VAVLIDTFLA KGKPKTKGAM RTLECIKAIS       120
     TAVYVTCDHV VWAGGAGAVD KRSTLYKVCD KLSLMGWAAG SALMAAGHVP DLIAYTRALR       180
     DPLASDNKRD DDVDEWELRE ELEEKTVASA LDVASGLTQA LFALSLLGAT PLKGRQMQCV       240
     GLAMGIVGVM RQLVSVPLPP EKTGMGRMGR LPISPSMPML R                           281
//

If you have problems or comments...

PBIL Back to PBIL home page